(data stored in ACNUC7421 zone)

EMBL: CP002293.PE244

CP002293.PE244       Location/Qualifiers
FT   CDS             280561..282189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0252"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: gwc:GWCH70_3147 drug resistance transporter,
FT                   EmrB/QacA subfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73100"
FT                   /db_xref="GOA:A0A0F6BI49"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI49"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADP73100.1"
FT                   /translation="MEKENELAMQSSTIRHRNILITGLIIAMLFGALDGTIVGTAMPRI
FT                   VGELGGLRLMTWLTTAYMLTSTAVVPIAGKLADLLGRRVIYVTGLVIFMVGSALCGMAD
FT                   KMTELVIYRGLQGIGGGIMMPMAMIVIGDVFTGKERAKWQGVFGALYGLASVLGPQIGG
FT                   FIVDHLNWRWVFYINLPIGILATIFIAMGLSKYKAEGPVKFDLAGMFTMIVGVVSLLLA
FT                   LTFGGDKYEWASWQIVTLFAVALVFLTVFVFVEMKAEEPILPMHLFRHRTFIVLNGIGF
FT                   LMSVGMFGAIMFVPFFMQGVIGVSATQSGTIMTPMMITMIIGSIVGGRTVYKIGVKSQI
FT                   FIGMVIMAAGFSLLSTMGVDTSKWTATLYMIILGLGMGLVMPILTLALQESFPKSELGV
FT                   VTSSSQFFRSIGGTFGMTILGAVMNHRSSQLLDDRFMPVLQSLPAQAKGMADRFAHMIH
FT                   DDPQGLYSILFSPEVLEKIPPQMRETFVPILKQSLVDSLHSVFLFGLIFVIGGTALVFG
FT                   MKKIKLSDKQRPLQTSGKNEKLPQS"
     MEKENELAMQ SSTIRHRNIL ITGLIIAMLF GALDGTIVGT AMPRIVGELG GLRLMTWLTT        60
     AYMLTSTAVV PIAGKLADLL GRRVIYVTGL VIFMVGSALC GMADKMTELV IYRGLQGIGG       120
     GIMMPMAMIV IGDVFTGKER AKWQGVFGAL YGLASVLGPQ IGGFIVDHLN WRWVFYINLP       180
     IGILATIFIA MGLSKYKAEG PVKFDLAGMF TMIVGVVSLL LALTFGGDKY EWASWQIVTL       240
     FAVALVFLTV FVFVEMKAEE PILPMHLFRH RTFIVLNGIG FLMSVGMFGA IMFVPFFMQG       300
     VIGVSATQSG TIMTPMMITM IIGSIVGGRT VYKIGVKSQI FIGMVIMAAG FSLLSTMGVD       360
     TSKWTATLYM IILGLGMGLV MPILTLALQE SFPKSELGVV TSSSQFFRSI GGTFGMTILG       420
     AVMNHRSSQL LDDRFMPVLQ SLPAQAKGMA DRFAHMIHDD PQGLYSILFS PEVLEKIPPQ       480
     MRETFVPILK QSLVDSLHSV FLFGLIFVIG GTALVFGMKK IKLSDKQRPL QTSGKNEKLP       540
     QS                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page