(data stored in SCRATCH zone)

EMBL: CP002293.PE245

CP002293.PE245       Location/Qualifiers
FT   CDS             complement(282308..282643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0253"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   gwc:GWCH70_3146 protein of unknown function DUF779"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73101"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI50"
FT                   /inference="protein motif:PFAM:PF05610"
FT                   /protein_id="ADP73101.1"
FT                   /translation="MSDQPKVIATEAALELIEKLKAKYGPLMFHQSGGCCDGSSPMCYP
FT                   QGDLIIGDSDVLLGEIGGCPFYISKAQYEYWKHTQLIIDVVPGRGGMFSLEGPEGVRFL
FT                   TRSKVFG"
     MSDQPKVIAT EAALELIEKL KAKYGPLMFH QSGGCCDGSS PMCYPQGDLI IGDSDVLLGE        60
     IGGCPFYISK AQYEYWKHTQ LIIDVVPGRG GMFSLEGPEG VRFLTRSKVF G                111
//

If you have problems or comments...

PBIL Back to PBIL home page