(data stored in SCRATCH zone)

EMBL: CP002293.PE246

CP002293.PE246       Location/Qualifiers
FT   CDS             complement(282710..284230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0254"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: gwc:GWCH70_3145
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73102"
FT                   /db_xref="GOA:A0A0F6BI51"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI51"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADP73102.1"
FT                   /translation="MIYAQPGQPGSLITFKKRYENFIGGKWVPPVDGEYFENISPVTGK
FT                   PYCEVPRSKAADIELALDAAHAAKDAWGRTSPAERARILNKIADRIEENLEMLAVAETW
FT                   ENGKPIRETLNADIPLAIDHFRYFAGCIRAEEGTLAEIDNDTVAYHFKEPLGVVGQIIP
FT                   WNFPLLMATWKLAPALAAGNCVVLKPAEQTPTSILVLMELIEDLLPPGVVNIVNGFGLE
FT                   AGKPLASSNRIAKIAFTGETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVAAKDDE
FT                   FFDKAIEGFTLFALNQGEICTCPSRALIQESIYDQFIERALERVKQIKQGNPLDTETMI
FT                   GAQASSEQLEKILSYIDIGKQEGAELLIGGERNFLEGDLRDGYYVKPTVFKGHNKMRIF
FT                   QEEIFGPVVSVTTFKDVNEALEIANETLYGLGAGVWTRDINTAYRVGRGIQAGRVWTNC
FT                   YHIYPAHAAFGGYKLSGFGRETHKMMLEHYQQTKNLLVSYSPKKLGLF"
     MIYAQPGQPG SLITFKKRYE NFIGGKWVPP VDGEYFENIS PVTGKPYCEV PRSKAADIEL        60
     ALDAAHAAKD AWGRTSPAER ARILNKIADR IEENLEMLAV AETWENGKPI RETLNADIPL       120
     AIDHFRYFAG CIRAEEGTLA EIDNDTVAYH FKEPLGVVGQ IIPWNFPLLM ATWKLAPALA       180
     AGNCVVLKPA EQTPTSILVL MELIEDLLPP GVVNIVNGFG LEAGKPLASS NRIAKIAFTG       240
     ETTTGRLIMQ YASQNIIPVT LELGGKSPNI FFEDVAAKDD EFFDKAIEGF TLFALNQGEI       300
     CTCPSRALIQ ESIYDQFIER ALERVKQIKQ GNPLDTETMI GAQASSEQLE KILSYIDIGK       360
     QEGAELLIGG ERNFLEGDLR DGYYVKPTVF KGHNKMRIFQ EEIFGPVVSV TTFKDVNEAL       420
     EIANETLYGL GAGVWTRDIN TAYRVGRGIQ AGRVWTNCYH IYPAHAAFGG YKLSGFGRET       480
     HKMMLEHYQQ TKNLLVSYSP KKLGLF                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page