(data stored in SCRATCH zone)

EMBL: CP002293.PE248

CP002293.PE248       Location/Qualifiers
FT   CDS             285138..285593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0256"
FT                   /product="protein of unknown function DUF1284"
FT                   /note="PFAM: protein of unknown function DUF1284; KEGG:
FT                   gwc:GWCH70_3142 protein of unknown function DUF1284"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73104"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI53"
FT                   /inference="protein motif:PFAM:PF06935"
FT                   /protein_id="ADP73104.1"
FT                   /translation="MKPLRLRGHHLLCVHGFRGMGYSPAFVEKMREVVAKIRDEEQDFL
FT                   IQVVAALDDACMACPHHGETACQAAPDSNEHVLSMDQKVIRHLGIEENGVYLKSELVQR
FT                   TAQKVRPDDLDYLCANCSWLPYGVCKEGIANVQRGNVAQKIEEDGRR"
     MKPLRLRGHH LLCVHGFRGM GYSPAFVEKM REVVAKIRDE EQDFLIQVVA ALDDACMACP        60
     HHGETACQAA PDSNEHVLSM DQKVIRHLGI EENGVYLKSE LVQRTAQKVR PDDLDYLCAN       120
     CSWLPYGVCK EGIANVQRGN VAQKIEEDGR R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page