(data stored in ACNUC7421 zone)

EMBL: CP002293.PE25

CP002293.PE25        Location/Qualifiers
FT   CDS             38462..39904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0025"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   gwc:GWCH70_0025 Orn/Lys/Arg decarboxylase major region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72881"
FT                   /db_xref="GOA:A0A0F6BHI0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI0"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADP72881.1"
FT                   /translation="MDQQRTPLYTALKRHDSIHPFSFHVPGHKYGIVFPKEAKDDYKQL
FT                   LKLDATELSGLDDLHHPESVIAEAQSLAAKLYNVEATFFLVNGSTVGNLAMIFAVCGEK
FT                   KKVIVQRNCHKSIMHALQLVGATPVFLPPEFDEDVRVASYVAYETIKKAIELHQDAAAL
FT                   VLTNPNYYGMAVDLTEVVNIAHRYRIPVLVDEAHGAHFVLGDPFPKTAITCGADVVVQS
FT                   AHKTLPAMTMGSYLHVNSSLIDKEKLKYFLQVFQSSSPSYPIMASLDLARSYLARLTRK
FT                   DIEDIFKQIQQLKDALDEIEGIAVVHSQHPFVKTDLLKITIQTRSQLSGYELQQRLEQE
FT                   GIFAELADPFNVLLVYPLAVVERLEEVIKKVKRAFHGLSYSEELLHSFRAFSFSASSAA
FT                   ISYKELQTLPKKVIDLEKAEGFIAAETITPYPPGVPLLFIGERISREHIEQIKRLKSYH
FT                   ARFQGGKFLSSDQIEVYSTSKK"
     MDQQRTPLYT ALKRHDSIHP FSFHVPGHKY GIVFPKEAKD DYKQLLKLDA TELSGLDDLH        60
     HPESVIAEAQ SLAAKLYNVE ATFFLVNGST VGNLAMIFAV CGEKKKVIVQ RNCHKSIMHA       120
     LQLVGATPVF LPPEFDEDVR VASYVAYETI KKAIELHQDA AALVLTNPNY YGMAVDLTEV       180
     VNIAHRYRIP VLVDEAHGAH FVLGDPFPKT AITCGADVVV QSAHKTLPAM TMGSYLHVNS       240
     SLIDKEKLKY FLQVFQSSSP SYPIMASLDL ARSYLARLTR KDIEDIFKQI QQLKDALDEI       300
     EGIAVVHSQH PFVKTDLLKI TIQTRSQLSG YELQQRLEQE GIFAELADPF NVLLVYPLAV       360
     VERLEEVIKK VKRAFHGLSY SEELLHSFRA FSFSASSAAI SYKELQTLPK KVIDLEKAEG       420
     FIAAETITPY PPGVPLLFIG ERISREHIEQ IKRLKSYHAR FQGGKFLSSD QIEVYSTSKK       480
//

If you have problems or comments...

PBIL Back to PBIL home page