(data stored in ACNUC7421 zone)

EMBL: CP002293.PE252

CP002293.PE252       Location/Qualifiers
FT   CDS             288292..288900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0260"
FT                   /product="sortase family protein"
FT                   /note="KEGG: gwc:GWCH70_3139 sortase family protein;
FT                   TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73108"
FT                   /db_xref="GOA:A0A0F6BI57"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR041999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI57"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADP73108.1"
FT                   /translation="MGERWETYKMRGAVLCMAAGLITAVWNGYSYWLGYNAVKPWKEER
FT                   KTPIAPQAADWQTAGTAAKPKIGDQIGTLLIPKLGISIPIYHGTETQQLRKGIGHYPKS
FT                   ALPGETNNMVLSGHRDTVFWQLGQIGIGDKLIVETAAKQFVYRVKKVRIVGENNRTVLV
FT                   EKPRPTLTVTTCYPFRFIGKAKQRYVLVAQLVSTIKKTG"
     MGERWETYKM RGAVLCMAAG LITAVWNGYS YWLGYNAVKP WKEERKTPIA PQAADWQTAG        60
     TAAKPKIGDQ IGTLLIPKLG ISIPIYHGTE TQQLRKGIGH YPKSALPGET NNMVLSGHRD       120
     TVFWQLGQIG IGDKLIVETA AKQFVYRVKK VRIVGENNRT VLVEKPRPTL TVTTCYPFRF       180
     IGKAKQRYVL VAQLVSTIKK TG                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page