(data stored in ACNUC7421 zone)

EMBL: CP002293.PE254

CP002293.PE254       Location/Qualifiers
FT   CDS             289680..290024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0262"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: gwc:GWCH70_3137 single-strand binding protein;
FT                   TIGRFAM: single-strand binding protein; PFAM: single-strand
FT                   binding protein/Primosomal replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73110"
FT                   /db_xref="GOA:A0A0F6BI59"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI59"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADP73110.1"
FT                   /translation="MINQVVLVGRLTKDPELRYTADGAAVVNITLAVTRNFRNAEGGID
FT                   TDFVQCTLWRKVAENTANYCRKGSIIGVMGRIQTRNYEKKDGQRVFVTEVVAESVRFMG
FT                   GKTHAWIEHS"
     MINQVVLVGR LTKDPELRYT ADGAAVVNIT LAVTRNFRNA EGGIDTDFVQ CTLWRKVAEN        60
     TANYCRKGSI IGVMGRIQTR NYEKKDGQRV FVTEVVAESV RFMGGKTHAW IEHS             114
//

If you have problems or comments...

PBIL Back to PBIL home page