(data stored in SCRATCH zone)

EMBL: CP002293.PE255

CP002293.PE255       Location/Qualifiers
FT   CDS             complement(290175..290594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0263"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: gwc:GWCH70_3135 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73111"
FT                   /db_xref="GOA:A0A0F6BI60"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI60"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP73111.1"
FT                   /translation="MKKMRKLGEKLKYLRKQHNWTQEQLAQHLNISRSQISKWENGELL
FT                   PDVQSLEKLSNLYEVSIDFLIGKHTTKKELLREMNLLYQTDRIDEKMLDIIDYFKQNPD
FT                   MEEMIYSLAQLPAKKRKHLETIIITLIQEFSDAVK"
     MKKMRKLGEK LKYLRKQHNW TQEQLAQHLN ISRSQISKWE NGELLPDVQS LEKLSNLYEV        60
     SIDFLIGKHT TKKELLREMN LLYQTDRIDE KMLDIIDYFK QNPDMEEMIY SLAQLPAKKR       120
     KHLETIIITL IQEFSDAVK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page