(data stored in SCRATCH zone)

EMBL: CP002293.PE256

CP002293.PE256       Location/Qualifiers
FT   CDS             290791..291291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73112"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI61"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3134"
FT                   /protein_id="ADP73112.1"
FT                   /translation="MIVNIYLADLIVSERKGLKQNKGTYRIFVKETRNPFSIRLKTIAP
FT                   TNFPDSLRFLKSGEQQSCSSGEETWFRTITCDSDAQLYFVFKSINQLYMFIVKLDLAKR
FT                   KFDISLYEWNQLQQKYLRLHTSELLTIEKQLVYYILQSFYIFENKRISYLFMCPARKNY
FT                   KKL"
     MIVNIYLADL IVSERKGLKQ NKGTYRIFVK ETRNPFSIRL KTIAPTNFPD SLRFLKSGEQ        60
     QSCSSGEETW FRTITCDSDA QLYFVFKSIN QLYMFIVKLD LAKRKFDISL YEWNQLQQKY       120
     LRLHTSELLT IEKQLVYYIL QSFYIFENKR ISYLFMCPAR KNYKKL                      166
//

If you have problems or comments...

PBIL Back to PBIL home page