(data stored in SCRATCH zone)

EMBL: CP002293.PE260

CP002293.PE260       Location/Qualifiers
FT   CDS             294979..295386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afl:Aflv_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI65"
FT                   /inference="similar to AA sequence:KEGG:Aflv_2676"
FT                   /protein_id="ADP73116.1"
FT                   /translation="MLKDLPHAVKVGITRSITRTFEAYMRDIEWNEQRFDPQVFMQRWR
FT                   NDIVRHSSWFHSLDDRLKANSVFHQELADKINSVIDKVLSEAPTEEQLAKIKELATLHG
FT                   EKDIPVSCKAEANYHIERLERLGNMDKTENK"
     MLKDLPHAVK VGITRSITRT FEAYMRDIEW NEQRFDPQVF MQRWRNDIVR HSSWFHSLDD        60
     RLKANSVFHQ ELADKINSVI DKVLSEAPTE EQLAKIKELA TLHGEKDIPV SCKAEANYHI       120
     ERLERLGNMD KTENK                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page