(data stored in ACNUC7421 zone)

EMBL: CP002293.PE261

CP002293.PE261       Location/Qualifiers
FT   CDS             295650..296930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0269"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; KEGG:
FT                   NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase ;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73117"
FT                   /db_xref="GOA:A0A0F6BI66"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI66"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADP73117.1"
FT                   /translation="MSKKICVIGLGYIGLPTSVMFANHGIQVHGVDINEKAVKMIQQKQ
FT                   LHIEEPGLQERLNKAIDSGKFTVSTQPEEADVFIIAVPSPINEDKTANLDYVRAATKSI
FT                   VPYVRKGNLVVLESTVPPRTVEDVMIPILREADLEIGTELFVSHSPERVIPGRIFEELV
FT                   NNDRIVGGINEESGRLTAELYKTFVKGKIHITDATTAEMVKVIENTYRDVNIAFANELA
FT                   KISEKIGVDVWEAIRLANFHPRVNIHLPGPGVGGHCIAVDPWFLVELQPELAKIVNLAR
FT                   QTNDSMPEYTALKIKQILENENIHHGRVAVFGLAFKGNVDDMRESPSLEVIHHLEKLGI
FT                   DYTAYDPHIKENKLARQTQQIEEAVARADIIAILTDHNEFKTLRPEKIAPLVRTKIILD
FT                   TKNCIDRNEWKKHGFHVLVLGDGKNQS"
     MSKKICVIGL GYIGLPTSVM FANHGIQVHG VDINEKAVKM IQQKQLHIEE PGLQERLNKA        60
     IDSGKFTVST QPEEADVFII AVPSPINEDK TANLDYVRAA TKSIVPYVRK GNLVVLESTV       120
     PPRTVEDVMI PILREADLEI GTELFVSHSP ERVIPGRIFE ELVNNDRIVG GINEESGRLT       180
     AELYKTFVKG KIHITDATTA EMVKVIENTY RDVNIAFANE LAKISEKIGV DVWEAIRLAN       240
     FHPRVNIHLP GPGVGGHCIA VDPWFLVELQ PELAKIVNLA RQTNDSMPEY TALKIKQILE       300
     NENIHHGRVA VFGLAFKGNV DDMRESPSLE VIHHLEKLGI DYTAYDPHIK ENKLARQTQQ       360
     IEEAVARADI IAILTDHNEF KTLRPEKIAP LVRTKIILDT KNCIDRNEWK KHGFHVLVLG       420
     DGKNQS                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page