(data stored in SCRATCH zone)

EMBL: CP002293.PE262

CP002293.PE262       Location/Qualifiers
FT   CDS             296973..297680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0270"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /EC_number="2.4.1.187"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; KEGG: tagA; N-acetylmannosaminyltransferase; PFAM:
FT                   glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73118"
FT                   /db_xref="GOA:A0A0F6BI67"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR034714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI67"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADP73118.1"
FT                   /translation="MKETFLGVDVCTYTYEQLVAKLMEDIDNNRKSFIVAINPEKIMKA
FT                   QQDDRLRELLNQATYPIPDGIGVVLASILKRGRIRSRVTGIDMMLRLCQEAAARGKKIF
FT                   LYGAKPGVADEAKRRLEKMFPGIQIVGTMHGYEKDEQVIKEAINQSGADILFVALGSPA
FT                   QEYWIANHMHSLSPKVYQGVGGSFDVISGRIKRAPLLVQKLGLEWLYRLLKEPWRWKRQ
FT                   LALPKFLIKVIRE"
     MKETFLGVDV CTYTYEQLVA KLMEDIDNNR KSFIVAINPE KIMKAQQDDR LRELLNQATY        60
     PIPDGIGVVL ASILKRGRIR SRVTGIDMML RLCQEAAARG KKIFLYGAKP GVADEAKRRL       120
     EKMFPGIQIV GTMHGYEKDE QVIKEAINQS GADILFVALG SPAQEYWIAN HMHSLSPKVY       180
     QGVGGSFDVI SGRIKRAPLL VQKLGLEWLY RLLKEPWRWK RQLALPKFLI KVIRE            235
//

If you have problems or comments...

PBIL Back to PBIL home page