(data stored in ACNUC7421 zone)

EMBL: CP002293.PE265

CP002293.PE265       Location/Qualifiers
FT   CDS             complement(300758..301657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73121"
FT                   /db_xref="InterPro:IPR030910"
FT                   /db_xref="InterPro:IPR030911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI70"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3048"
FT                   /protein_id="ADP73121.1"
FT                   /translation="MFPFFKKQKQQKDEHDSVVEANELSENSEADSDEEEVKTELSFHP
FT                   SWNVSIEERYYYQFLHNQQRPLKKNQISLSGIDLKQVPRGYVVTAFVRNSLSRPVAFTP
FT                   APLLLLGPNNEVLARKVFDLSELGEVPPRSSRPWKFLFEQETLRTSELPLVDWKLAFEL
FT                   PKQKHHSLDLAESWEKSLAAEDKQKLQALVQSLQPPKPGEVNFMGLQAQQTEQGDLHVT
FT                   LLIRNGSDKNIHIEQLALQVHDASGDIVASGAFSLDHFEVKANTSKPWTFIFPKSLVTK
FT                   ENPDLRSWKVSLPSSQPS"
     MFPFFKKQKQ QKDEHDSVVE ANELSENSEA DSDEEEVKTE LSFHPSWNVS IEERYYYQFL        60
     HNQQRPLKKN QISLSGIDLK QVPRGYVVTA FVRNSLSRPV AFTPAPLLLL GPNNEVLARK       120
     VFDLSELGEV PPRSSRPWKF LFEQETLRTS ELPLVDWKLA FELPKQKHHS LDLAESWEKS       180
     LAAEDKQKLQ ALVQSLQPPK PGEVNFMGLQ AQQTEQGDLH VTLLIRNGSD KNIHIEQLAL       240
     QVHDASGDIV ASGAFSLDHF EVKANTSKPW TFIFPKSLVT KENPDLRSWK VSLPSSQPS        299
//

If you have problems or comments...

PBIL Back to PBIL home page