(data stored in SCRATCH zone)

EMBL: CP002293.PE266

CP002293.PE266       Location/Qualifiers
FT   CDS             complement(301678..304053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0274"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: afl:Aflv_2639 preprotein translocase subunit
FT                   SecA; TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73122"
FT                   /db_xref="GOA:A0A0F6BI71"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030908"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI71"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADP73122.1"
FT                   /translation="MLSYVKKLLNSDERRLKRYYKIVDHINALEPKFAKLSDQELREKT
FT                   AYFKNELANGKTVFDIQAEAFAVVREAAKRVLGMRHFDVQLIGGLVLAEGNIAEMATGE
FT                   GKTLVASLPSYLRALEGKGVHVITVNEYLARRDRELIGQIHEFLGLTVGLNLPMMETEE
FT                   KKAAYQADITYGIGSEFGFDYLRDNMVYDISQRVQRPFHYAIIDEIDSILIDEAKTPLI
FT                   IAGKTGVSSELSYLCARIVKTLERDVDYYYDEETKATNLTEEGIAKIERGFGIDNLYDV
FT                   EHQTLYHYIIQALRAHVLFQRDVDYIVRDGKIVLIDMFTGRPMEGRSLSHGLHQAIEAK
FT                   EGLELTEENKTQAAITIQNYFRLYPILSGMTGTAKTEEKEFQTLYGMDVVQIPTNKPVI
FT                   RVDEPDRVFLTIDQKYKAVAKEVKRVHETGQPVLIGTTSILQSEKVAKYLEAENLPFRL
FT                   LNAKTIEQEAQLIALAGQKGQITIATNMAGRGTDIMLGEGVAELGGLFVLGTERHEARR
FT                   IDNQLKGRAGRQGDPGRSQFFISLEDDMFRRFAKEETEKWMKKAKTDENGEILNKEIHE
FT                   FVDRVQRICEGNSFSIREYNLKLDDVLNDQRTAVYRLRNRILEGDRLIPLVIDMLHSYV
FT                   PYEIEQHCPADMLPEEWDLEKLTEQLREIIPFPAVQLSGNINDIEDVKSNVQHSLEQYI
FT                   HYLETMNDAEQVKAEIRPSLLSIVDYYWLNHLDAMERLKEGIGLRFYSQEDPIRQYQRE
FT                   GFELFVYMYHQIEADICRRLAQAVAPKAAASESAGKTS"
     MLSYVKKLLN SDERRLKRYY KIVDHINALE PKFAKLSDQE LREKTAYFKN ELANGKTVFD        60
     IQAEAFAVVR EAAKRVLGMR HFDVQLIGGL VLAEGNIAEM ATGEGKTLVA SLPSYLRALE       120
     GKGVHVITVN EYLARRDREL IGQIHEFLGL TVGLNLPMME TEEKKAAYQA DITYGIGSEF       180
     GFDYLRDNMV YDISQRVQRP FHYAIIDEID SILIDEAKTP LIIAGKTGVS SELSYLCARI       240
     VKTLERDVDY YYDEETKATN LTEEGIAKIE RGFGIDNLYD VEHQTLYHYI IQALRAHVLF       300
     QRDVDYIVRD GKIVLIDMFT GRPMEGRSLS HGLHQAIEAK EGLELTEENK TQAAITIQNY       360
     FRLYPILSGM TGTAKTEEKE FQTLYGMDVV QIPTNKPVIR VDEPDRVFLT IDQKYKAVAK       420
     EVKRVHETGQ PVLIGTTSIL QSEKVAKYLE AENLPFRLLN AKTIEQEAQL IALAGQKGQI       480
     TIATNMAGRG TDIMLGEGVA ELGGLFVLGT ERHEARRIDN QLKGRAGRQG DPGRSQFFIS       540
     LEDDMFRRFA KEETEKWMKK AKTDENGEIL NKEIHEFVDR VQRICEGNSF SIREYNLKLD       600
     DVLNDQRTAV YRLRNRILEG DRLIPLVIDM LHSYVPYEIE QHCPADMLPE EWDLEKLTEQ       660
     LREIIPFPAV QLSGNINDIE DVKSNVQHSL EQYIHYLETM NDAEQVKAEI RPSLLSIVDY       720
     YWLNHLDAME RLKEGIGLRF YSQEDPIRQY QREGFELFVY MYHQIEADIC RRLAQAVAPK       780
     AAASESAGKT S                                                            791
//

If you have problems or comments...

PBIL Back to PBIL home page