(data stored in ACNUC7421 zone)

EMBL: CP002293.PE267

CP002293.PE267       Location/Qualifiers
FT   CDS             304441..307920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0275"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; KEGG: afl:Aflv_2637
FT                   secreted subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73123"
FT                   /db_xref="GOA:A0A0F6BI72"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI72"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADP73123.1"
FT                   /translation="MKKWKKTAVSLGLASALVLPSFAQASTMPPLEQWKKQHAQQHAAK
FT                   ARLAYQRLKEAKDQISEDTLIVKYKEKIPASVHRSLGATLKKSFPQLGYDVVTVQKGKT
FT                   AKEVIRAYAKLKAVKSVTPSFTYKKVSTNDPKNDKMYPLSLLQIDKALQLAGKHSVTVA
FT                   VIDSGVDTKHPDLKAQLLPAYNAVNPAGPVVKDIHGTHVAGIIGATANNGVGAHGINPN
FT                   VKILPIDVFNGEWGASDYVIAQGILYAIEKGAKVINMSLVGYFNSPILEDAVKKAIDAG
FT                   VTVVASAGNEATDEYAVPASYEGVISVGATDSKNHLANFSNYGPSVDIVAPGVDVYSTV
FT                   YDPTKGASFAELSGTSMASPVVAGVASLILSKYPDLKPYEVEAILEKTATDLGEKGYDL
FT                   KYANGLVNPVAALNFDIKKLPKKETWSDETILAKAAPLQLTEETTTKTGSLTAPEQIDW
FT                   LKVDVNAGESIQAVLEGAEDYDYKLILRFYPEGKKQSEKPINVNDTRAGEIEGKLFTAK
FT                   ENGTLVIGVTDANGNYSTQGKSEYTLTLQKLTTLAEDNSTKDNPVAIEQLPFDSDKSEF
FT                   APFTFIPEKEGEVDHDYFTFKVEEPTTVKLNLSPVPGINSTISVYLAEDFYHPADPENG
FT                   PYPIVPPVNNNGSGKGETVTFEADPEMEYVIEVASEPPLDFWYYGLSPQSSGANGDTPA
FT                   SAIPYRLTVEPVTMPPDEDGYPLTDDEEEPAPSEETTPAEEAQLNKKAKEKKDIIIIIE
FT                   DNVPLSFEKEDIQHIKENALPYSLGDKQSAHIQFGEDRDFYKLSSVDDTAVYRFTFDVP
FT                   DDMQPEAVVYEYDPKQDDLYPISEFNGYDYFTGQKTNTFTLFLEKGKQYYLSVANGRYQ
FT                   PSADPYTFTSEKLMDAPKDVNENNNEPIRATVVQPNKAVTGNFALNNDEDIYYYKHRAN
FT                   DDIFTFFARPDKLANKASLPAELQGTLIPIVTVVEDTNGNMSIDDEEVGKMVEFWPTGL
FT                   NPLYDVNGSFKAKKNTGYFFIINSYLYDGLTLQSYRFGIETLPKKDEDAGSVVKNNVPS
FT                   KPLSLKQSGNTFKATGYLNASVDYGDKDYYVFTAAKDGKFTVQLAGGVTMDGVISIYNE
FT                   KGGLVQTFDYYGEGDSEIATVTLKKGKYYIVVEDSFARPSAQPYTLSVSPVK"
     MKKWKKTAVS LGLASALVLP SFAQASTMPP LEQWKKQHAQ QHAAKARLAY QRLKEAKDQI        60
     SEDTLIVKYK EKIPASVHRS LGATLKKSFP QLGYDVVTVQ KGKTAKEVIR AYAKLKAVKS       120
     VTPSFTYKKV STNDPKNDKM YPLSLLQIDK ALQLAGKHSV TVAVIDSGVD TKHPDLKAQL       180
     LPAYNAVNPA GPVVKDIHGT HVAGIIGATA NNGVGAHGIN PNVKILPIDV FNGEWGASDY       240
     VIAQGILYAI EKGAKVINMS LVGYFNSPIL EDAVKKAIDA GVTVVASAGN EATDEYAVPA       300
     SYEGVISVGA TDSKNHLANF SNYGPSVDIV APGVDVYSTV YDPTKGASFA ELSGTSMASP       360
     VVAGVASLIL SKYPDLKPYE VEAILEKTAT DLGEKGYDLK YANGLVNPVA ALNFDIKKLP       420
     KKETWSDETI LAKAAPLQLT EETTTKTGSL TAPEQIDWLK VDVNAGESIQ AVLEGAEDYD       480
     YKLILRFYPE GKKQSEKPIN VNDTRAGEIE GKLFTAKENG TLVIGVTDAN GNYSTQGKSE       540
     YTLTLQKLTT LAEDNSTKDN PVAIEQLPFD SDKSEFAPFT FIPEKEGEVD HDYFTFKVEE       600
     PTTVKLNLSP VPGINSTISV YLAEDFYHPA DPENGPYPIV PPVNNNGSGK GETVTFEADP       660
     EMEYVIEVAS EPPLDFWYYG LSPQSSGANG DTPASAIPYR LTVEPVTMPP DEDGYPLTDD       720
     EEEPAPSEET TPAEEAQLNK KAKEKKDIII IIEDNVPLSF EKEDIQHIKE NALPYSLGDK       780
     QSAHIQFGED RDFYKLSSVD DTAVYRFTFD VPDDMQPEAV VYEYDPKQDD LYPISEFNGY       840
     DYFTGQKTNT FTLFLEKGKQ YYLSVANGRY QPSADPYTFT SEKLMDAPKD VNENNNEPIR       900
     ATVVQPNKAV TGNFALNNDE DIYYYKHRAN DDIFTFFARP DKLANKASLP AELQGTLIPI       960
     VTVVEDTNGN MSIDDEEVGK MVEFWPTGLN PLYDVNGSFK AKKNTGYFFI INSYLYDGLT      1020
     LQSYRFGIET LPKKDEDAGS VVKNNVPSKP LSLKQSGNTF KATGYLNASV DYGDKDYYVF      1080
     TAAKDGKFTV QLAGGVTMDG VISIYNEKGG LVQTFDYYGE GDSEIATVTL KKGKYYIVVE      1140
     DSFARPSAQP YTLSVSPVK                                                   1159
//

If you have problems or comments...

PBIL Back to PBIL home page