(data stored in ACNUC7421 zone)

EMBL: CP002293.PE269

CP002293.PE269       Location/Qualifiers
FT   CDS             complement(309683..310669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0277"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; S-layer domain-containing
FT                   protein; KEGG: afl:Aflv_2635 cell wall-associated hydrolase
FT                   containing three SLH domains"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73125"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI74"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADP73125.1"
FT                   /translation="MRRQLVLALLLGGSVFAAGARAEQAEASVNYDHIVPAAKQYIGVP
FT                   YRWGGTTAKGFDCSGFIRHVYQSIGIDTPRTATDMYRMGKRVDKSALRVGDLVFFNTSG
FT                   KGVSHAGIYIGNNRFIHSSSSKGVTISSLNDSYWKKTYIGAKRVLAYRLAPGQFQDVSP
FT                   SHWAFDEVRTLSEQELVIGYEDSYFKPDEPITRAEVAAYLAEYLDLNLSDRSVPFNDVP
FT                   DDYWALGAIRAVQKQGIMNGSNGKFHPEDTLTRAQLAAVLTRAFRLQPPAAAKSFTDVP
FT                   PSFWAFRDIQALAAAGIATGRTDGSFGPNEPVTRVQFAAFLYRAMHQ"
     MRRQLVLALL LGGSVFAAGA RAEQAEASVN YDHIVPAAKQ YIGVPYRWGG TTAKGFDCSG        60
     FIRHVYQSIG IDTPRTATDM YRMGKRVDKS ALRVGDLVFF NTSGKGVSHA GIYIGNNRFI       120
     HSSSSKGVTI SSLNDSYWKK TYIGAKRVLA YRLAPGQFQD VSPSHWAFDE VRTLSEQELV       180
     IGYEDSYFKP DEPITRAEVA AYLAEYLDLN LSDRSVPFND VPDDYWALGA IRAVQKQGIM       240
     NGSNGKFHPE DTLTRAQLAA VLTRAFRLQP PAAAKSFTDV PPSFWAFRDI QALAAAGIAT       300
     GRTDGSFGPN EPVTRVQFAA FLYRAMHQ                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page