(data stored in SCRATCH zone)

EMBL: CP002293.PE27

CP002293.PE27        Location/Qualifiers
FT   CDS             40637..41629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0027"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: gwc:GWCH70_0027 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72883"
FT                   /db_xref="GOA:A0A0F6BHI2"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI2"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADP72883.1"
FT                   /translation="MAMEWEQLERYQPAVVKMLTKSLEKGRISHAYLFEGQRGTGKKAM
FT                   SLLLAKSLFCLNRSGIKPCNECRNCRRIDSGNHPDVHIIEPDGQSVKKEQIEMLQQEFT
FT                   KTAVESDRKLYIIEHADKMTTNAANSLLKFLEEPRPGTVAILLTEQYHRMLETIISRCQ
FT                   VFSFKPIPPALLANYLEKQQIPPHIAFLAAHVTNNYEEALQLSRDDWFAQARKIVLQLY
FT                   ETLKKNDLQALFFVHDQWLPHFQEKPQIDLGLDLLLYIYKDMLHIQLGQVEQIIYRDRL
FT                   DDLRQWSLSCPQRQIVKSMEMILRAKARLNTTNMSVQLLMEQLILDLKE"
     MAMEWEQLER YQPAVVKMLT KSLEKGRISH AYLFEGQRGT GKKAMSLLLA KSLFCLNRSG        60
     IKPCNECRNC RRIDSGNHPD VHIIEPDGQS VKKEQIEMLQ QEFTKTAVES DRKLYIIEHA       120
     DKMTTNAANS LLKFLEEPRP GTVAILLTEQ YHRMLETIIS RCQVFSFKPI PPALLANYLE       180
     KQQIPPHIAF LAAHVTNNYE EALQLSRDDW FAQARKIVLQ LYETLKKNDL QALFFVHDQW       240
     LPHFQEKPQI DLGLDLLLYI YKDMLHIQLG QVEQIIYRDR LDDLRQWSLS CPQRQIVKSM       300
     EMILRAKARL NTTNMSVQLL MEQLILDLKE                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page