(data stored in SCRATCH zone)

EMBL: CP002293.PE270

CP002293.PE270       Location/Qualifiers
FT   CDS             311109..314252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0278"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   afl:Aflv_2634 S-layer glycoprotein protein, contains three
FT                   N-terminal SLH domains"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73126"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI75"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADP73126.1"
FT                   /translation="MAYQPKSYRKFLAGSVSAALVATAVGPVVANAASFSDVNPNDSHA
FT                   ANINALVELGYIKGFTDGTFKPYQSITRGQVAKIFARILTDQGFQAPDKIEQVFDDVPL
FT                   DAKDQELVKAAAIVKAAGVMTGSQGKLNPAQNITREQMAKVLVEAFDLTKPADFTSKIT
FT                   DLDKADPSFRDYIQTLEANGVTVVTEYRPKDSVTRAAFASFVKRALDVSSVVTADDITE
FT                   VKFVDENTLEVTFNGELKEVKKEDFAIEGVEIDSVSIKAAASAEGKTTVVVIKTKTKLE
FT                   EGKTYTISYKGKTTDKAKVEVPVVTPKVESVSAINAKQIEIKFNTKMDKDSVTDVTKYS
FT                   IKRAGVPAVKLSDVSSANEYATAELSEDGKTLTITFKNALTTPAWGSIAEGDTFNFETA
FT                   KLKAANGKEIDAASYAVKYSDKVAPVFVSAKAVAKTTTNKITLTFSEPIDYSVATVSVD
FT                   GVFGSLSAGSKPNELVVTTNANLEVGKTYNLQILNVKDVAGNLLTPNPVNTTVTVTSDT
FT                   AAPVVTDVKVVRDNLIEVTFDKSMDASTLTANGTVKLMDANFSNTNAISSVTPKDNTDN
FT                   KVFLVALNPVSFNDNGNFLGTLVISDSAKDSLGNAIATTTKAVSLVKDTVKPQAISVKY
FT                   VKATTYGDQTGLTNGALVVKFSEEIQTSTGSIVVVDDQGQTISVGSPVVNGKDKTELII
FT                   PLTAPVAQTAKFYTVSVSAGTVKDLSSQQNSNALATLTADVSAGAVTGKDTAAPSITSI
FT                   SGVAAVKATSTGNQITFTIQDQANAGETASGVDFTTVTDVNNYRLDGAPLPSGSYVKVT
FT                   GSDPSYTVTIQLPFGAISKDKNYSLNINGIKDKAGNVITPVAVNNVELKDDVQPELKTA
FT                   TLNANGTVSLGFSEDVVPVATASSAVLDFTVELNGSTLTKPAASPATDLAYELIDGTGA
FT                   DAGKYVLRVKVSKETQTVTDAATGITINGVKYTVDNDGDNLLFKFIDVNGNKTADNGDI
FT                   ILSATDVDSTTQSFDFDSYYDLTKATSLKVGTVATPTVVTDTSTLANELVGNKKITVK"
     MAYQPKSYRK FLAGSVSAAL VATAVGPVVA NAASFSDVNP NDSHAANINA LVELGYIKGF        60
     TDGTFKPYQS ITRGQVAKIF ARILTDQGFQ APDKIEQVFD DVPLDAKDQE LVKAAAIVKA       120
     AGVMTGSQGK LNPAQNITRE QMAKVLVEAF DLTKPADFTS KITDLDKADP SFRDYIQTLE       180
     ANGVTVVTEY RPKDSVTRAA FASFVKRALD VSSVVTADDI TEVKFVDENT LEVTFNGELK       240
     EVKKEDFAIE GVEIDSVSIK AAASAEGKTT VVVIKTKTKL EEGKTYTISY KGKTTDKAKV       300
     EVPVVTPKVE SVSAINAKQI EIKFNTKMDK DSVTDVTKYS IKRAGVPAVK LSDVSSANEY       360
     ATAELSEDGK TLTITFKNAL TTPAWGSIAE GDTFNFETAK LKAANGKEID AASYAVKYSD       420
     KVAPVFVSAK AVAKTTTNKI TLTFSEPIDY SVATVSVDGV FGSLSAGSKP NELVVTTNAN       480
     LEVGKTYNLQ ILNVKDVAGN LLTPNPVNTT VTVTSDTAAP VVTDVKVVRD NLIEVTFDKS       540
     MDASTLTANG TVKLMDANFS NTNAISSVTP KDNTDNKVFL VALNPVSFND NGNFLGTLVI       600
     SDSAKDSLGN AIATTTKAVS LVKDTVKPQA ISVKYVKATT YGDQTGLTNG ALVVKFSEEI       660
     QTSTGSIVVV DDQGQTISVG SPVVNGKDKT ELIIPLTAPV AQTAKFYTVS VSAGTVKDLS       720
     SQQNSNALAT LTADVSAGAV TGKDTAAPSI TSISGVAAVK ATSTGNQITF TIQDQANAGE       780
     TASGVDFTTV TDVNNYRLDG APLPSGSYVK VTGSDPSYTV TIQLPFGAIS KDKNYSLNIN       840
     GIKDKAGNVI TPVAVNNVEL KDDVQPELKT ATLNANGTVS LGFSEDVVPV ATASSAVLDF       900
     TVELNGSTLT KPAASPATDL AYELIDGTGA DAGKYVLRVK VSKETQTVTD AATGITINGV       960
     KYTVDNDGDN LLFKFIDVNG NKTADNGDII LSATDVDSTT QSFDFDSYYD LTKATSLKVG      1020
     TVATPTVVTD TSTLANELVG NKKITVK                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page