(data stored in ACNUC7421 zone)

EMBL: CP002293.PE271

CP002293.PE271       Location/Qualifiers
FT   CDS             314767..316284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0279"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bha:BH3998
FT                   transposase (25)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73127"
FT                   /db_xref="GOA:A0A0F6BI76"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI76"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP73127.1"
FT                   /translation="MLAVAEIHYIRYEANQKGCSYSDIAKRMNRDPRTVKKYAEMEDFN
FT                   PSKVKQTRKAKVMDPVKPILDQWIKEDLTKKKKYRRTAKRMYEILKEEYGFTGSDRSVR
FT                   LYVSKRKQELLEQSESAALPLESKPAMAQVDFGEAPFLYQGKYVDFPYLVVSFPYSNAA
FT                   YVQVMPAQNQECFLEGLKRIFHYMGRVPRVIRFDNLSPAVKTILPNGERELTETFQRFV
FT                   LHYGFECEFCNPASGNEKGNVESKVKYIRNNFFLPEQTIYQLESFNESLWEKCEKDWNR
FT                   PHYEKERLIAELFEEEQALFLQLPAKEFECVRYEQVTADKYGFIHLENNLYSTSPRFAK
FT                   QKVLAKISYHEIAILTEEHELIIKHERLYGTKQKSMKWQPYLTLMAKRPNALKYTDFYE
FT                   KMPEEWKNYFSNCTVQEKKEALQLLAVLLKEHDFEVSTQALRIASQYGHPKVESIKQVF
FT                   YQLINGRGIREPIQPKKHVPDMPEAIRGVRHYDRLFESQGDVASWNK"
     MLAVAEIHYI RYEANQKGCS YSDIAKRMNR DPRTVKKYAE MEDFNPSKVK QTRKAKVMDP        60
     VKPILDQWIK EDLTKKKKYR RTAKRMYEIL KEEYGFTGSD RSVRLYVSKR KQELLEQSES       120
     AALPLESKPA MAQVDFGEAP FLYQGKYVDF PYLVVSFPYS NAAYVQVMPA QNQECFLEGL       180
     KRIFHYMGRV PRVIRFDNLS PAVKTILPNG ERELTETFQR FVLHYGFECE FCNPASGNEK       240
     GNVESKVKYI RNNFFLPEQT IYQLESFNES LWEKCEKDWN RPHYEKERLI AELFEEEQAL       300
     FLQLPAKEFE CVRYEQVTAD KYGFIHLENN LYSTSPRFAK QKVLAKISYH EIAILTEEHE       360
     LIIKHERLYG TKQKSMKWQP YLTLMAKRPN ALKYTDFYEK MPEEWKNYFS NCTVQEKKEA       420
     LQLLAVLLKE HDFEVSTQAL RIASQYGHPK VESIKQVFYQ LINGRGIREP IQPKKHVPDM       480
     PEAIRGVRHY DRLFESQGDV ASWNK                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page