(data stored in SCRATCH zone)

EMBL: CP002293.PE272

CP002293.PE272       Location/Qualifiers
FT   CDS             316272..316991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0280"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="manually curated; PFAM: IstB domain protein
FT                   ATP-binding protein; KEGG: bha:BH3999 transposase (26);
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73128"
FT                   /db_xref="GOA:A0A0F6BI77"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI77"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP73128.1"
FT                   /translation="MEQMIKEYAKRLKLSWIPANYHTIHAETNEEFLLKLFEREVQHRD
FT                   ERRINLLLKQATLPKIPNKPYDWREIQLAPGITKDYILEGEFTKNQENLIFYGGVGTGK
FT                   TFLSTLIALNLMKKQGKRVKFYTAASIVNALLEANEKGDLGKFLNQIEKLDLLILDELG
FT                   YIPLHKQGAELLFQVISMCYETKSIIVTTNLPFSQWNNVFGDPILTEAVIDRLIHHSHL
FT                   IIFNGESHRYKDSISQR"
     MEQMIKEYAK RLKLSWIPAN YHTIHAETNE EFLLKLFERE VQHRDERRIN LLLKQATLPK        60
     IPNKPYDWRE IQLAPGITKD YILEGEFTKN QENLIFYGGV GTGKTFLSTL IALNLMKKQG       120
     KRVKFYTAAS IVNALLEANE KGDLGKFLNQ IEKLDLLILD ELGYIPLHKQ GAELLFQVIS       180
     MCYETKSIIV TTNLPFSQWN NVFGDPILTE AVIDRLIHHS HLIIFNGESH RYKDSISQR        239
//

If you have problems or comments...

PBIL Back to PBIL home page