(data stored in ACNUC7421 zone)

EMBL: CP002293.PE275

CP002293.PE275       Location/Qualifiers
FT   CDS             318700..319071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73131"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI80"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3095"
FT                   /protein_id="ADP73131.1"
FT                   /translation="MKTLEDLQELILEKYNVELRFVEDVKQDIKAINKGHRQTVLLEIL
FT                   RRAKQGPLFKPDGVAESLHGDLHGFAKIKSKSLNIRIIYRPVEGQPIRMEIIAIGPRDK
FT                   KKAYRMAAERLQKFFMEMD"
     MKTLEDLQEL ILEKYNVELR FVEDVKQDIK AINKGHRQTV LLEILRRAKQ GPLFKPDGVA        60
     ESLHGDLHGF AKIKSKSLNI RIIYRPVEGQ PIRMEIIAIG PRDKKKAYRM AAERLQKFFM       120
     EMD                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page