(data stored in ACNUC7421 zone)

EMBL: CP002293.PE276

CP002293.PE276       Location/Qualifiers
FT   CDS             complement(319323..320522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73132"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI81"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3094"
FT                   /protein_id="ADP73132.1"
FT                   /translation="MKKGKKTNHQFLEELFQVWGNEFEPLEEYKGYDQPIKVRHKQCGR
FT                   ILDKTPKNLITLKLGCRICKNKENGKKRRKNHDWFVNEVKKLVGNEYQVRSEYTRSKDP
FT                   IKMYHTVCNEEFTTTPDAFLGSRNGDGKKGNRCPKCSGKWKRDTEAFKQEVYKMYGDEF
FT                   EVIGEYKGRHENIKILHKVCNNYLYPRPRHFLDGNSYCQYCSKKEKKDTQRFKEQVYEL
FT                   VGDEYIVLGEYVDAKTPIPLYHKKCKTVYRVTPDNFLRGKRCGLCTDIHNSKGYKAIYN
FT                   LLFANQLPFDTQYRDENCRNIKPLPFDFVLYNNWRLDKIIAFIEFDGEQHDKPSNLFGG
FT                   EEGFKERQKNDQIKNDFAKEKGIPLIRIKYKDLNNIESVLQEELKKINIYIDINKTNVI
FT                   "
     MKKGKKTNHQ FLEELFQVWG NEFEPLEEYK GYDQPIKVRH KQCGRILDKT PKNLITLKLG        60
     CRICKNKENG KKRRKNHDWF VNEVKKLVGN EYQVRSEYTR SKDPIKMYHT VCNEEFTTTP       120
     DAFLGSRNGD GKKGNRCPKC SGKWKRDTEA FKQEVYKMYG DEFEVIGEYK GRHENIKILH       180
     KVCNNYLYPR PRHFLDGNSY CQYCSKKEKK DTQRFKEQVY ELVGDEYIVL GEYVDAKTPI       240
     PLYHKKCKTV YRVTPDNFLR GKRCGLCTDI HNSKGYKAIY NLLFANQLPF DTQYRDENCR       300
     NIKPLPFDFV LYNNWRLDKI IAFIEFDGEQ HDKPSNLFGG EEGFKERQKN DQIKNDFAKE       360
     KGIPLIRIKY KDLNNIESVL QEELKKINIY IDINKTNVI                              399
//

If you have problems or comments...

PBIL Back to PBIL home page