(data stored in ACNUC7421 zone)

EMBL: CP002293.PE278

CP002293.PE278       Location/Qualifiers
FT   CDS             321700..322092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI83"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3068"
FT                   /protein_id="ADP73134.1"
FT                   /translation="MVNTNKIVGQNVKKYIESKGIKHSWVMERTGIKKTAYYNFLKGEG
FT                   NVEEYVAKINKLFRIKDPFFFYKSDMEFKEKTFERSRSDSFMNHVALSFHGTVDEELKK
FT                   GMRLFSEFVELIDVLKSVTNSENPRG"
     MVNTNKIVGQ NVKKYIESKG IKHSWVMERT GIKKTAYYNF LKGEGNVEEY VAKINKLFRI        60
     KDPFFFYKSD MEFKEKTFER SRSDSFMNHV ALSFHGTVDE ELKKGMRLFS EFVELIDVLK       120
     SVTNSENPRG                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page