(data stored in ACNUC7421 zone)

EMBL: CP002293.PE280

CP002293.PE280       Location/Qualifiers
FT   CDS             322888..323730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI85"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3066"
FT                   /protein_id="ADP73136.1"
FT                   /translation="MKVLDSPVLESVRPFISDNTEQLYQSLNEHQAFYMFDNMILTKLR
FT                   KQISNLPLLLQAFHQSPVFLIPDVVLEESFRNIPTKERYNDYYFELFKQLSAKKQLYII
FT                   SMETIYQLLEKGMTKKQYIFDVMKQLALEAFRVNRDIINNLERCELSSFSDLPKLRQII
FT                   LHNGNNAGERFICFFALLLVHQYYGPAYICSDDGKGVYTMYNTFVNNESLFRILGVDDF
FT                   LMLKEQYILLSYDCILQLSIKNTGLSSKEIYAFVQSSGRNDVYCKIKIQSSARKTCRA"
     MKVLDSPVLE SVRPFISDNT EQLYQSLNEH QAFYMFDNMI LTKLRKQISN LPLLLQAFHQ        60
     SPVFLIPDVV LEESFRNIPT KERYNDYYFE LFKQLSAKKQ LYIISMETIY QLLEKGMTKK       120
     QYIFDVMKQL ALEAFRVNRD IINNLERCEL SSFSDLPKLR QIILHNGNNA GERFICFFAL       180
     LLVHQYYGPA YICSDDGKGV YTMYNTFVNN ESLFRILGVD DFLMLKEQYI LLSYDCILQL       240
     SIKNTGLSSK EIYAFVQSSG RNDVYCKIKI QSSARKTCRA                             280
//

If you have problems or comments...

PBIL Back to PBIL home page