(data stored in SCRATCH zone)

EMBL: CP002293.PE283

CP002293.PE283       Location/Qualifiers
FT   CDS             complement(326661..327926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73139"
FT                   /db_xref="GOA:A0A0F6BI88"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI88"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3053"
FT                   /protein_id="ADP73139.1"
FT                   /translation="MVLPDKKRKIIVAIMLLTALAFRLFVLWKYGLSLTLHSDDTAYIR
FT                   SGKILAEKGMIVYHYNHINEPTVHIMPGLPMLLAAIFFIFGTGDMGLYAAKAVMILFGV
FT                   ASVFLIYAIGKDINHEWAGIIAGFSTALFVPLIEIDNLILTEPPFLFGLLLFIRFAVQL
FT                   GRNHSMSAFYGLMFAYLFCLLFRATVALIPFALLGYFLLIKYPLRLAWKQLGIAVLLVI
FT                   IVLGPWWVRNYIHYKEFIPLTGSSGDPLLLGTYQGDGYRYGEPYEEVIKKIDEQYPHIT
FT                   IRKKQELEKEIAIERIKRWYKANPKQFIESYTIKKAKIQWETPFYPVEILDVKKPFIIS
FT                   LHQRIVLLAFASVALTLLLLKRNRKELLFLTFIIAYFTVLNNVFFAYSRYNLPLMPLLF
FT                   LYIGLLVSAVWHMLFRKKAASS"
     MVLPDKKRKI IVAIMLLTAL AFRLFVLWKY GLSLTLHSDD TAYIRSGKIL AEKGMIVYHY        60
     NHINEPTVHI MPGLPMLLAA IFFIFGTGDM GLYAAKAVMI LFGVASVFLI YAIGKDINHE       120
     WAGIIAGFST ALFVPLIEID NLILTEPPFL FGLLLFIRFA VQLGRNHSMS AFYGLMFAYL       180
     FCLLFRATVA LIPFALLGYF LLIKYPLRLA WKQLGIAVLL VIIVLGPWWV RNYIHYKEFI       240
     PLTGSSGDPL LLGTYQGDGY RYGEPYEEVI KKIDEQYPHI TIRKKQELEK EIAIERIKRW       300
     YKANPKQFIE SYTIKKAKIQ WETPFYPVEI LDVKKPFIIS LHQRIVLLAF ASVALTLLLL       360
     KRNRKELLFL TFIIAYFTVL NNVFFAYSRY NLPLMPLLFL YIGLLVSAVW HMLFRKKAAS       420
     S                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page