(data stored in ACNUC7421 zone)

EMBL: CP002293.PE284

CP002293.PE284       Location/Qualifiers
FT   CDS             complement(327943..328311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0293"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gwc:GWCH70_3052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73140"
FT                   /db_xref="GOA:A0A0F6BI89"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI89"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP73140.1"
FT                   /translation="MNLINFLLILSNTCILVIGQFLWKYGMMKTSFSLDPFSIIKLLFS
FT                   PFIFSGLVMYGAATILWLFILSRVPLSVAYPVQSIAYVLAVFGAYFVFHEPLSPAKIIG
FT                   VILIILGVSLIGISPNTQ"
     MNLINFLLIL SNTCILVIGQ FLWKYGMMKT SFSLDPFSII KLLFSPFIFS GLVMYGAATI        60
     LWLFILSRVP LSVAYPVQSI AYVLAVFGAY FVFHEPLSPA KIIGVILIIL GVSLIGISPN       120
     TQ                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page