(data stored in SCRATCH zone)

EMBL: CP002293.PE285

CP002293.PE285       Location/Qualifiers
FT   CDS             complement(328298..328666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73141"
FT                   /db_xref="GOA:A0A0F6BI90"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI90"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3051"
FT                   /protein_id="ADP73141.1"
FT                   /translation="MGKVQIITIAFASLFLIQVVYYSSRNKLRDKQAFLWFLMAFIGIF
FT                   IAVCLDWFNKIAALLGVAYMPALIFTIAFLVILNILIYQSVTLSDHQEKIKTLVQEIAY
FT                   LKHELEEYQRKGEKDESH"
     MGKVQIITIA FASLFLIQVV YYSSRNKLRD KQAFLWFLMA FIGIFIAVCL DWFNKIAALL        60
     GVAYMPALIF TIAFLVILNI LIYQSVTLSD HQEKIKTLVQ EIAYLKHELE EYQRKGEKDE       120
     SH                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page