(data stored in ACNUC7421 zone)

EMBL: CP002293.PE287

CP002293.PE287       Location/Qualifiers
FT   CDS             329776..330972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0296"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   xbo:XBJ1_4052 conserved hypothetical protein; putative
FT                   exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73143"
FT                   /db_xref="GOA:A0A0F6BI92"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI92"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADP73143.1"
FT                   /translation="MKSVLFAFLLFIPFFSFFNHHVKAAELHTYIKAVKHHVPLLDNST
FT                   GSLVEVGYMEKGDILKVYKDQGKNWWQIKFGNSYAYVYKGNVESFKAKAIRGENTSLKN
FT                   SNHTILLMKNQRIYDNSTGKLIPFVTIKGNMRYPIIRKLKDWYQIDVGGRIGYIHHSKA
FT                   NWDHGVPVLMYHHILKRSENKNYRNVSTTISDSQFYEQMDWLKENGYETITLQRLEQYV
FT                   RGKANIPAKAVVITFDDGLKTSFIYAYPKLKKLGFKAANFVITGRIPKAPQKFNPDGLQ
FT                   FLSQSEMAAMSDVFTFESHTHQLHHLNGKKSYVVIKPYNVVKEDIKRSKDILGARYFAY
FT                   PFGQYNSSIIRMLNELDFKLAVTTKEGKVHIGDPLLEIKRLGVYPEYTLKDFSKMVQN"
     MKSVLFAFLL FIPFFSFFNH HVKAAELHTY IKAVKHHVPL LDNSTGSLVE VGYMEKGDIL        60
     KVYKDQGKNW WQIKFGNSYA YVYKGNVESF KAKAIRGENT SLKNSNHTIL LMKNQRIYDN       120
     STGKLIPFVT IKGNMRYPII RKLKDWYQID VGGRIGYIHH SKANWDHGVP VLMYHHILKR       180
     SENKNYRNVS TTISDSQFYE QMDWLKENGY ETITLQRLEQ YVRGKANIPA KAVVITFDDG       240
     LKTSFIYAYP KLKKLGFKAA NFVITGRIPK APQKFNPDGL QFLSQSEMAA MSDVFTFESH       300
     THQLHHLNGK KSYVVIKPYN VVKEDIKRSK DILGARYFAY PFGQYNSSII RMLNELDFKL       360
     AVTTKEGKVH IGDPLLEIKR LGVYPEYTLK DFSKMVQN                               398
//

If you have problems or comments...

PBIL Back to PBIL home page