(data stored in ACNUC7421 zone)

EMBL: CP002293.PE29

CP002293.PE29        Location/Qualifiers
FT   CDS             42488..42853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0029"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   gwc:GWCH70_0029 protein of unknown function DUF972"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72885"
FT                   /db_xref="GOA:A0A0F6BHI4"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI4"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ADP72885.1"
FT                   /translation="MDKKEIFQSVTGMEEQLSHLYRQLVQLKEYVAELLEENHHLQIEN
FT                   DHLRRRLEQMSGELEEEKRKEKDHKHSHERRLIDIGEGYDNLARLYQEGFHICHVHYGS
FT                   VRKEGDCLFCLSFLNKK"
     MDKKEIFQSV TGMEEQLSHL YRQLVQLKEY VAELLEENHH LQIENDHLRR RLEQMSGELE        60
     EEKRKEKDHK HSHERRLIDI GEGYDNLARL YQEGFHICHV HYGSVRKEGD CLFCLSFLNK       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page