(data stored in SCRATCH zone)

EMBL: CP002293.PE290

CP002293.PE290       Location/Qualifiers
FT   CDS             336631..337740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0301"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: gka:GK1472 hypothetical protein; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73146"
FT                   /db_xref="GOA:A0A0F6BI95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI95"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP73146.1"
FT                   /translation="MEKHCRLAVAITGSGKGIGKYLLSLMTQPPGAFVDKIPIMPPPGI
FT                   LRGVLPLRRLIDKFKDVDKKSGFLAPSLPTDLSYSELSFMTKRGFLGKKLSQYLGFNKD
FT                   EGDFLFYLSLSKPSFTNPDSENKGECILYLSELMLKWSEQKQDIPYQIKRLDVRPDIQN
FT                   AMLKAYDMFKDELFSSSDAAEEREIDACCCGGQWEVYRDVMFAATQGKFLLLTEEEVSK
FT                   YKEGIVLCEGRVKDRSDIPICRNLAKEKLESEGLSQPTIMRWLLVLSEAITNAIKHAEE
FT                   GTMTILKDEKNNEIRFVIEDKGPGFALKDLPKKTLLAGYSTKKSLGQGFTLMMTIAKRV
FT                   LLFTSPKGSVLILSFDIHKKNRDQLGNAG"
     MEKHCRLAVA ITGSGKGIGK YLLSLMTQPP GAFVDKIPIM PPPGILRGVL PLRRLIDKFK        60
     DVDKKSGFLA PSLPTDLSYS ELSFMTKRGF LGKKLSQYLG FNKDEGDFLF YLSLSKPSFT       120
     NPDSENKGEC ILYLSELMLK WSEQKQDIPY QIKRLDVRPD IQNAMLKAYD MFKDELFSSS       180
     DAAEEREIDA CCCGGQWEVY RDVMFAATQG KFLLLTEEEV SKYKEGIVLC EGRVKDRSDI       240
     PICRNLAKEK LESEGLSQPT IMRWLLVLSE AITNAIKHAE EGTMTILKDE KNNEIRFVIE       300
     DKGPGFALKD LPKKTLLAGY STKKSLGQGF TLMMTIAKRV LLFTSPKGSV LILSFDIHKK       360
     NRDQLGNAG                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page