(data stored in SCRATCH zone)

EMBL: CP002293.PE291

CP002293.PE291       Location/Qualifiers
FT   CDS             337873..337977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73147.1"
FT                   /translation="MAKEQTTAATEIAGFAVGIARTGKRMIGNIQPVA"
     MAKEQTTAAT EIAGFAVGIA RTGKRMIGNI QPVA                                    34
//

If you have problems or comments...

PBIL Back to PBIL home page