(data stored in ACNUC7421 zone)

EMBL: CP002293.PE292

CP002293.PE292       Location/Qualifiers
FT   CDS             338018..338335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0303"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: bpf:BpOF4_13060 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73148"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI97"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADP73148.1"
FT                   /translation="MSLTVNKKVKGKTLILKVKGVLDISTVHVIASYLKEIDHIETLIF
FT                   DLSDLELIDSTGIGTILNAIYLSQEKHFKLKLQGMDELTDNVFETVGLYQILEAMQGEV
FT                   N"
     MSLTVNKKVK GKTLILKVKG VLDISTVHVI ASYLKEIDHI ETLIFDLSDL ELIDSTGIGT        60
     ILNAIYLSQE KHFKLKLQGM DELTDNVFET VGLYQILEAM QGEVN                       105
//

If you have problems or comments...

PBIL Back to PBIL home page