(data stored in ACNUC7421 zone)

EMBL: CP002293.PE293

CP002293.PE293       Location/Qualifiers
FT   CDS             338335..339165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0304"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: bpf:BpOF4_13065 hypothetical protein; PFAM:
FT                   Stage II sporulation protein E; SMART: protein phosphatase
FT                   2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73149"
FT                   /db_xref="GOA:A0A0F6BI98"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI98"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP73149.1"
FT                   /translation="MYKYRPTFTQRERVIDNQQIMDNMDKTLQREINLARNIQMQLLNG
FT                   KTPEFEGGEVIGSSLPARLIGGDYYDFYPLVNGKIRIVVGDVMGKGIPAAMLMILTRDA
FT                   FRRVAEITDSPAETLTSMNQALYEDLRTLKSFVTLICADYDPKTGIFTYASAGHHLPLY
FT                   INGRDKTIKELPKVSGIMLGGLPDQVYKEMSIQLDEQDIIFFYTDGIVEAQNKDGEQYK
FT                   LERLVQTLLENHEKSVGEIERSVMDSIHQFTQGVPQKDDITMVLLKVSKQKNGY"
     MYKYRPTFTQ RERVIDNQQI MDNMDKTLQR EINLARNIQM QLLNGKTPEF EGGEVIGSSL        60
     PARLIGGDYY DFYPLVNGKI RIVVGDVMGK GIPAAMLMIL TRDAFRRVAE ITDSPAETLT       120
     SMNQALYEDL RTLKSFVTLI CADYDPKTGI FTYASAGHHL PLYINGRDKT IKELPKVSGI       180
     MLGGLPDQVY KEMSIQLDEQ DIIFFYTDGI VEAQNKDGEQ YKLERLVQTL LENHEKSVGE       240
     IERSVMDSIH QFTQGVPQKD DITMVLLKVS KQKNGY                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page