(data stored in ACNUC7421 zone)

EMBL: CP002293.PE294

CP002293.PE294       Location/Qualifiers
FT   CDS             339207..341288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0305"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   bpf:BpOF4_13070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73150"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI99"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADP73150.1"
FT                   /translation="MQSIVAKGKDINEAIELGLKLLGTEKEKVSIEIIQTETKGFLGIG
FT                   AKPAIVKLTKLEAAEAQQAPDKNDVIEQAVSEINMEEVAVLSDFLPEREHEGEHQIDTK
FT                   EPDALVGKAWVKNGALFCKTSPTHFPTVTIGEGVKLYRNHELVKEKTTIVTENDVYEIK
FT                   VENEKKDTKWKVWMDEKKLKVFLYVEPGYKITRKLPDIEPSQHIELVVEEYKEVYNTLS
FT                   YADVMQKLESLQVAHQFIRQEQIVKALEAKEPGTYEIAAGVSAKDGKNGWIELNVDLQS
FT                   HNGPIANEDGKVDYREIRTIPSVDRGQVIATIHPPVPGQPGVTVTNEPIPPEPAYPVVL
FT                   QAGRGIMEVDGKIVATESGRPQVKQKGRLVKVSVMPKLTHPGNVDLSSGNIRFTGDVEI
FT                   FGEVEKNMVVEAKGDIIVHQTVNMASLIASGAIVSYGNIISSEISAGKHNMLVAELGNL
FT                   LGIIQQNMEKMIGVIRQLLQSPAFKSNDFSRGGLQPLIRILLEKKFQSFPPFVKKYVEM
FT                   VRNGESDLEDDGWKEIADSLTKLFLSLTNEVISLEWMIQLSQKMKELHKTSVSPAEPDS
FT                   YISIPSALNSRIYCGGDVFVTGKGGCINTKIHAGGALKINGVVRGGEVYGGLGAEINET
FT                   GSERGISTVIAVPRDQKIRINKAMEGTVLKIGNAKYTLKETRHYVSARLDQDDRIVFE"
     MQSIVAKGKD INEAIELGLK LLGTEKEKVS IEIIQTETKG FLGIGAKPAI VKLTKLEAAE        60
     AQQAPDKNDV IEQAVSEINM EEVAVLSDFL PEREHEGEHQ IDTKEPDALV GKAWVKNGAL       120
     FCKTSPTHFP TVTIGEGVKL YRNHELVKEK TTIVTENDVY EIKVENEKKD TKWKVWMDEK       180
     KLKVFLYVEP GYKITRKLPD IEPSQHIELV VEEYKEVYNT LSYADVMQKL ESLQVAHQFI       240
     RQEQIVKALE AKEPGTYEIA AGVSAKDGKN GWIELNVDLQ SHNGPIANED GKVDYREIRT       300
     IPSVDRGQVI ATIHPPVPGQ PGVTVTNEPI PPEPAYPVVL QAGRGIMEVD GKIVATESGR       360
     PQVKQKGRLV KVSVMPKLTH PGNVDLSSGN IRFTGDVEIF GEVEKNMVVE AKGDIIVHQT       420
     VNMASLIASG AIVSYGNIIS SEISAGKHNM LVAELGNLLG IIQQNMEKMI GVIRQLLQSP       480
     AFKSNDFSRG GLQPLIRILL EKKFQSFPPF VKKYVEMVRN GESDLEDDGW KEIADSLTKL       540
     FLSLTNEVIS LEWMIQLSQK MKELHKTSVS PAEPDSYISI PSALNSRIYC GGDVFVTGKG       600
     GCINTKIHAG GALKINGVVR GGEVYGGLGA EINETGSERG ISTVIAVPRD QKIRINKAME       660
     GTVLKIGNAK YTLKETRHYV SARLDQDDRI VFE                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page