(data stored in ACNUC7421 zone)

EMBL: CP002293.PE296

CP002293.PE296       Location/Qualifiers
FT   CDS             complement(341811..342998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0307"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: gwc:GWCH70_3058 efflux transporter, RND
FT                   family, MFP subunit; TIGRFAM: efflux transporter, RND
FT                   family, MFP subunit; PFAM: secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73152"
FT                   /db_xref="GOA:A0A0F6BIA1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA1"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADP73152.1"
FT                   /translation="MKRWKRYIFLVIVLCICANFYMLFHEHSKIPKSVYVNERTKPEKT
FT                   TIKETVRTGGFTAPAERKFVYYDPQLGVIDEILVAKGQEVQVGTPLIRYADADIDREIQ
FT                   RIALKKEQLHAQIEQLAKDIDHYTTLSSSAEEEDSMKIQWEEKAREAEREKTLFEWKIK
FT                   EYEEQQNELTEKKDELVVESKTAGIIEEISYDKSKPLITIASPSAIVRGKAKEGTIEKL
FT                   AIGQAAVVRVPNEKESFAGTIAAIGKIPVKEASFQEKSEYPFTVQLNEQPKQLPFGYHV
FT                   NITVVTKEKSGAITIPAEAVWREKTKSFVYVIHNGKLEKRKVTLGIAHGEKQEIEQGLR
FT                   ENEYIVSHPAKQMKHGMDVIVPLDLEKPTKETIKQLSKWDIVKHFLDGFFRSFHS"
     MKRWKRYIFL VIVLCICANF YMLFHEHSKI PKSVYVNERT KPEKTTIKET VRTGGFTAPA        60
     ERKFVYYDPQ LGVIDEILVA KGQEVQVGTP LIRYADADID REIQRIALKK EQLHAQIEQL       120
     AKDIDHYTTL SSSAEEEDSM KIQWEEKARE AEREKTLFEW KIKEYEEQQN ELTEKKDELV       180
     VESKTAGIIE EISYDKSKPL ITIASPSAIV RGKAKEGTIE KLAIGQAAVV RVPNEKESFA       240
     GTIAAIGKIP VKEASFQEKS EYPFTVQLNE QPKQLPFGYH VNITVVTKEK SGAITIPAEA       300
     VWREKTKSFV YVIHNGKLEK RKVTLGIAHG EKQEIEQGLR ENEYIVSHPA KQMKHGMDVI       360
     VPLDLEKPTK ETIKQLSKWD IVKHFLDGFF RSFHS                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page