(data stored in SCRATCH zone)

EMBL: CP002293.PE298

CP002293.PE298       Location/Qualifiers
FT   CDS             complement(344033..345775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73154"
FT                   /db_xref="GOA:A0A0F6BIA3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA3"
FT                   /inference="similar to AA sequence:KEGG:BMD_5208"
FT                   /protein_id="ADP73154.1"
FT                   /translation="MLKNGIFSAIAALASAICTVLFFSPIHWNILAEGGILFLLLFAAY
FT                   YIVLQNKTRFVAPLSRSKRWAAGLFMLLFPLFTVISMKGEQTHLQHSPLAVKFVIYIGT
FT                   YVSIIMLTLFIVSLILSVTPDRPDPGKKWGYIFVYALPPLIVWAFYLIAFFPGAMTADS
FT                   IFQWEQAHTGKFNDWHPLMYTLFIMLVTSVWDSPAAIGIAQIIIISLVIGYCLFELEKA
FT                   GAPKWAVWAVSILFAVSPINGIYSITVWKDILYSTFILLFTTLIGKLIMTNGDWLKRFP
FT                   AFIFFTVTALGVVFFRHNGFVVCLATLIILSAAFRHLWKQWLLVLSLVVAIHYAVTGPL
FT                   FAYLKVTPSDPNEALSIPTQQIARVITYNGKMTEQQAEYIHKIMPLDLWKKLYNPYLTD
FT                   PIKFSRHYNRQAIFPDHLSTYLQTWWEICRQNPRLVIEAMAKQTSLVWQMNEPKDGYTS
FT                   MFVTNVFYGNKFGLKNEVIFQPITKTVGTYLKWSETAGKPFIWRPAVYMFFIILFTFIA
FT                   FLRNDRKALLLPIAVLLNIGTVFIALPAQDFRYLYSNSLVFFIAFLFALVSYRNDGNTL
FT                   SQKR"
     MLKNGIFSAI AALASAICTV LFFSPIHWNI LAEGGILFLL LFAAYYIVLQ NKTRFVAPLS        60
     RSKRWAAGLF MLLFPLFTVI SMKGEQTHLQ HSPLAVKFVI YIGTYVSIIM LTLFIVSLIL       120
     SVTPDRPDPG KKWGYIFVYA LPPLIVWAFY LIAFFPGAMT ADSIFQWEQA HTGKFNDWHP       180
     LMYTLFIMLV TSVWDSPAAI GIAQIIIISL VIGYCLFELE KAGAPKWAVW AVSILFAVSP       240
     INGIYSITVW KDILYSTFIL LFTTLIGKLI MTNGDWLKRF PAFIFFTVTA LGVVFFRHNG       300
     FVVCLATLII LSAAFRHLWK QWLLVLSLVV AIHYAVTGPL FAYLKVTPSD PNEALSIPTQ       360
     QIARVITYNG KMTEQQAEYI HKIMPLDLWK KLYNPYLTDP IKFSRHYNRQ AIFPDHLSTY       420
     LQTWWEICRQ NPRLVIEAMA KQTSLVWQMN EPKDGYTSMF VTNVFYGNKF GLKNEVIFQP       480
     ITKTVGTYLK WSETAGKPFI WRPAVYMFFI ILFTFIAFLR NDRKALLLPI AVLLNIGTVF       540
     IALPAQDFRY LYSNSLVFFI AFLFALVSYR NDGNTLSQKR                             580
//

If you have problems or comments...

PBIL Back to PBIL home page