(data stored in ACNUC7421 zone)

EMBL: CP002293.PE301

CP002293.PE301       Location/Qualifiers
FT   CDS             complement(350146..350493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0312"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: membrane protein, transporter of
FT                   cations and cationic drugs"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73157"
FT                   /db_xref="GOA:A0A0F6BIA6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA6"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP73157.1"
FT                   /translation="MNTFIQSIKKNKIGIILILLASVSTASGQMFWKLSGGQWNRHLIL
FT                   GFLFYGIGAILMTIAFRFGSLSVLHPLLSMGYVFALLLGVTFLDEHITATRAMAVVLIV
FT                   TGAVLIGGGDD"
     MNTFIQSIKK NKIGIILILL ASVSTASGQM FWKLSGGQWN RHLILGFLFY GIGAILMTIA        60
     FRFGSLSVLH PLLSMGYVFA LLLGVTFLDE HITATRAMAV VLIVTGAVLI GGGDD            115
//

If you have problems or comments...

PBIL Back to PBIL home page