(data stored in ACNUC7421 zone)

EMBL: CP002293.PE303

CP002293.PE303       Location/Qualifiers
FT   CDS             352019..354313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0314"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; S-layer domain-containing protein; KEGG:
FT                   afl:Aflv_2606 subtilisin-type proteinase with two SLH
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73159"
FT                   /db_xref="GOA:A0A0F6BIA8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA8"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADP73159.1"
FT                   /translation="MRNPLLFMCCLLIGFIFLFEKDVHSQSLSEWVVYFQSEKDYSLFM
FT                   EKYRDRVKDQEKEKQWAVKALFTKEEIGGIQKLSIVSKVEPNYQKSLASSFFNDPLVSQ
FT                   QWGINKIDILSVASKFQQRNMLIGKQIATAQGVMAYEGQPLPMLSFSVLSEEEMKLSRL
FT                   SATVDHVENTWTLQVTDKDGKVLAQNSGNLSTLDVLLPKNQTYKTLQIHIQANGWKKPP
FT                   VITNMTAVNHVLVAVIDTGAALHKDFCGNVLHSLGKDYVHPGRLALDDHGHGTHVTGII
FT                   AACANNHEGIVGAAGFAPVDVVPFKVLDREGTGGDFEIAKAVNDAVSMGADVINLSLAG
FT                   KGKTLVLEQAVQNALQHHVVVVAAAGNWGISLQDVYPASYPGVIAVAAVDEHNQIASYS
FT                   DYGWKLDISAPGDNILSTFINNEYRTLSGTSMAAPFVSGVAALLKATDPRLDDIQIRKR
FT                   LFESAEDIQEKGYDIHSGYGVVQAAKAIQLPYSEAVDWLTIKSGQPLSFSEKQILGISK
FT                   GLIGKDVYVFIDDQLVEKRNMDDQWLSFALPDVPSARNEKKLTVVGADHTGKVAAFDER
FT                   WVNSAASASASFSDVPSSFWAYEEIQTAYREKWINGFTDHTFRPNALLTRRHAVMMMNR
FT                   LFQWRPQQIRSPFLDTPLTLAGALPIYAAYGQRIVKGYDDGHFYPERFVTRAQMAVMLA
FT                   RALKLSEDSFSGTPYAFKDMDGSFAYYAVQQLADKGIVTKQPYFRPNEFLTRAQFAAML
FT                   ARTYQYMLDKK"
     MRNPLLFMCC LLIGFIFLFE KDVHSQSLSE WVVYFQSEKD YSLFMEKYRD RVKDQEKEKQ        60
     WAVKALFTKE EIGGIQKLSI VSKVEPNYQK SLASSFFNDP LVSQQWGINK IDILSVASKF       120
     QQRNMLIGKQ IATAQGVMAY EGQPLPMLSF SVLSEEEMKL SRLSATVDHV ENTWTLQVTD       180
     KDGKVLAQNS GNLSTLDVLL PKNQTYKTLQ IHIQANGWKK PPVITNMTAV NHVLVAVIDT       240
     GAALHKDFCG NVLHSLGKDY VHPGRLALDD HGHGTHVTGI IAACANNHEG IVGAAGFAPV       300
     DVVPFKVLDR EGTGGDFEIA KAVNDAVSMG ADVINLSLAG KGKTLVLEQA VQNALQHHVV       360
     VVAAAGNWGI SLQDVYPASY PGVIAVAAVD EHNQIASYSD YGWKLDISAP GDNILSTFIN       420
     NEYRTLSGTS MAAPFVSGVA ALLKATDPRL DDIQIRKRLF ESAEDIQEKG YDIHSGYGVV       480
     QAAKAIQLPY SEAVDWLTIK SGQPLSFSEK QILGISKGLI GKDVYVFIDD QLVEKRNMDD       540
     QWLSFALPDV PSARNEKKLT VVGADHTGKV AAFDERWVNS AASASASFSD VPSSFWAYEE       600
     IQTAYREKWI NGFTDHTFRP NALLTRRHAV MMMNRLFQWR PQQIRSPFLD TPLTLAGALP       660
     IYAAYGQRIV KGYDDGHFYP ERFVTRAQMA VMLARALKLS EDSFSGTPYA FKDMDGSFAY       720
     YAVQQLADKG IVTKQPYFRP NEFLTRAQFA AMLARTYQYM LDKK                        764
//

If you have problems or comments...

PBIL Back to PBIL home page