(data stored in ACNUC7421 zone)

EMBL: CP002293.PE304

CP002293.PE304       Location/Qualifiers
FT   CDS             354445..355995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0315"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bca:BCE_2458 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73160"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BPB5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADP73160.1"
FT                   /translation="MYIYYNRDQLILPMDLEILIPKHHLCRIVDLAVEKMDPALLVSLY
FT                   PGGGRPAYHPKMMLKVILYAYANRIYSSRQIAKQLKENIYFMWLSGHQTPDFRTINRFR
FT                   SERMKDIIYETFFSIVDLLRQEGLVKLEDYFLDGTKIEASANKYTFVWRKSTEKYDQKL
FT                   EEKFRKIVASIEQVVKEDEESEQEGDFQEKLEASPITSEKIEAVIEQVEEHLKKEPKNR
FT                   TLKKAKQQLEQDILPRKKKYEEYKKVLGERNSFSKTDPDATFMRMKDDHMKNGQLKPGY
FT                   NVQIGTENQFITGFSVHQRAGDAGCFIPHLEQLAAYGRPMPKRAIADSAYGSEENYTYC
FT                   EKKQIVALIKYNTLDREQTKAWAKEIGRIENMTYDEELDEWICAKGERLVFVYKRKETT
FT                   DNGYVIVKRTYRCTACAGCPFQAACAKGKDTKTIRVSLKNQQQRQEIRKRLSTEEGATT
FT                   YRRRQIENEPVFGQIKHNQQFHRFSLRGLPKITLEWGLVCAAHNLRKWATTTDPTRKK"
     MYIYYNRDQL ILPMDLEILI PKHHLCRIVD LAVEKMDPAL LVSLYPGGGR PAYHPKMMLK        60
     VILYAYANRI YSSRQIAKQL KENIYFMWLS GHQTPDFRTI NRFRSERMKD IIYETFFSIV       120
     DLLRQEGLVK LEDYFLDGTK IEASANKYTF VWRKSTEKYD QKLEEKFRKI VASIEQVVKE       180
     DEESEQEGDF QEKLEASPIT SEKIEAVIEQ VEEHLKKEPK NRTLKKAKQQ LEQDILPRKK       240
     KYEEYKKVLG ERNSFSKTDP DATFMRMKDD HMKNGQLKPG YNVQIGTENQ FITGFSVHQR       300
     AGDAGCFIPH LEQLAAYGRP MPKRAIADSA YGSEENYTYC EKKQIVALIK YNTLDREQTK       360
     AWAKEIGRIE NMTYDEELDE WICAKGERLV FVYKRKETTD NGYVIVKRTY RCTACAGCPF       420
     QAACAKGKDT KTIRVSLKNQ QQRQEIRKRL STEEGATTYR RRQIENEPVF GQIKHNQQFH       480
     RFSLRGLPKI TLEWGLVCAA HNLRKWATTT DPTRKK                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page