(data stored in SCRATCH zone)

EMBL: CP002293.PE306

CP002293.PE306       Location/Qualifiers
FT   CDS             356249..357778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0317"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: afl:Aflv_2605 N-acetylmuramoyl-L-alanine
FT                   amidase containing SLH domains; PFAM: cell wall
FT                   hydrolase/autolysin; SH3 type 3 domain protein; S-layer
FT                   domain-containing protein; SMART: cell wall
FT                   hydrolase/autolysin; SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73162"
FT                   /db_xref="GOA:A0A0F6BIB1"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB1"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADP73162.1"
FT                   /translation="MQPLRLLLLCLLMFFGYSSATYAETNSSAASSQGDLQKIQDFHQP
FT                   SPFNAESASASFSAASTAKTIFADVPADHWAKKEIEFLYGRAIIQGYNENGVLRFHPNE
FT                   NVTRAQAAKMIVKALGQSEKTVTRARFKDVPPSHWAAGWIERAVENGIFQGYSDGTFQP
FT                   DAPLKRSQMSKIIALAFKLPEPGNVGNKQIFRDISPSYWAYPYIVKLYYHGISNGSENQ
FT                   FMPESYTSRAQFSAFVARALNKDFRLPVNSSPVNSSVIATGKVTADTLNVRSSGSTSAS
FT                   VIGQLSYGTVVNVLEINGYWAKISYNGKTGYVHKTYLKLKNVNGNPVQGRIIVIDAGHG
FT                   GTDPGTMNGKTYEKNIVLSVAQKVKQKLASAGAKVIMTRESDVYKTLEERVQIAKNNYA
FT                   ELFVSIHVNSASPSASGTETYYDTSKNPNGYESYLLAKAIQQQIVNNAGMKDRGVKDYG
FT                   FYVVRNNNVPSVLVELGFITNSSDYQKLTSDHYQNIFAQSIYNGIVQYYSQ"
     MQPLRLLLLC LLMFFGYSSA TYAETNSSAA SSQGDLQKIQ DFHQPSPFNA ESASASFSAA        60
     STAKTIFADV PADHWAKKEI EFLYGRAIIQ GYNENGVLRF HPNENVTRAQ AAKMIVKALG       120
     QSEKTVTRAR FKDVPPSHWA AGWIERAVEN GIFQGYSDGT FQPDAPLKRS QMSKIIALAF       180
     KLPEPGNVGN KQIFRDISPS YWAYPYIVKL YYHGISNGSE NQFMPESYTS RAQFSAFVAR       240
     ALNKDFRLPV NSSPVNSSVI ATGKVTADTL NVRSSGSTSA SVIGQLSYGT VVNVLEINGY       300
     WAKISYNGKT GYVHKTYLKL KNVNGNPVQG RIIVIDAGHG GTDPGTMNGK TYEKNIVLSV       360
     AQKVKQKLAS AGAKVIMTRE SDVYKTLEER VQIAKNNYAE LFVSIHVNSA SPSASGTETY       420
     YDTSKNPNGY ESYLLAKAIQ QQIVNNAGMK DRGVKDYGFY VVRNNNVPSV LVELGFITNS       480
     SDYQKLTSDH YQNIFAQSIY NGIVQYYSQ                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page