(data stored in ACNUC7421 zone)

EMBL: CP002293.PE307

CP002293.PE307       Location/Qualifiers
FT   CDS             357950..359104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0318"
FT                   /product="putative pyruvyl-transferase"
FT                   /note="KEGG: gtn:GTNG_3096 putative pyruvyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73163"
FT                   /db_xref="GOA:A0A0F6BIB2"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB2"
FT                   /inference="similar to AA sequence:KEGG:GTNG_3096"
FT                   /protein_id="ADP73163.1"
FT                   /translation="MKIGIIGNYGHNNNGDEAILTGILKQLIEELSIPNEDIIVFSNNP
FT                   KDTEQRYGVRAVPIFHRKGPLPFSIMKTLKENYLIMRNLDVIIVGGGGILMDLYKWDGP
FT                   LYATLGLLGHYAGCKVIVYGVGVGPIETKLGAFFIKQLSQKACCISVRDEQSKRLLQAL
FT                   GVKRNIHVIGDPALYLAAPNEKQESHFVQKVAVTAVPYYNGKYWPTSNEQKYSNYVTGM
FT                   AKNLDQLIEKKNVAVTFFSTKYPQDVQVTKDIAALMKHRDRVTIIDKNLHPNDIVSLCA
FT                   SHDLVIGTRLHSLILAVVARTPIIGIGYHPKVYHFLSLIRQTDRYVSVETLGMEPASIV
FT                   QIVEKMEKKWLDIQRETRQIAEQMKEKAGEGIELLRLSGEKHVR"
     MKIGIIGNYG HNNNGDEAIL TGILKQLIEE LSIPNEDIIV FSNNPKDTEQ RYGVRAVPIF        60
     HRKGPLPFSI MKTLKENYLI MRNLDVIIVG GGGILMDLYK WDGPLYATLG LLGHYAGCKV       120
     IVYGVGVGPI ETKLGAFFIK QLSQKACCIS VRDEQSKRLL QALGVKRNIH VIGDPALYLA       180
     APNEKQESHF VQKVAVTAVP YYNGKYWPTS NEQKYSNYVT GMAKNLDQLI EKKNVAVTFF       240
     STKYPQDVQV TKDIAALMKH RDRVTIIDKN LHPNDIVSLC ASHDLVIGTR LHSLILAVVA       300
     RTPIIGIGYH PKVYHFLSLI RQTDRYVSVE TLGMEPASIV QIVEKMEKKW LDIQRETRQI       360
     AEQMKEKAGE GIELLRLSGE KHVR                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page