(data stored in ACNUC7421 zone)

EMBL: CP002293.PE308

CP002293.PE308       Location/Qualifiers
FT   CDS             359127..360188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0319"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: mth:MTH450
FT                   LPS biosynthesis RfbU related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73164"
FT                   /db_xref="GOA:A0A0F6BIB3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP73164.1"
FT                   /translation="MYPTETAKSFGIFVKNQVEALRGRGLHVDVIAVTNPRTDKVNVLT
FT                   KYILWLLRTLIHCVTKGRNYDVVHAHYVFPTGMLGLWYKKWWKAKLVVTAHGGDIDRMA
FT                   NKSGRIRQWTTTILREADHVIAVGHKLAEQIRNEFGVPEENVSVINMGVNRRIFQPLDK
FT                   EEARKRCGIGEHEIPILFVGNIIRQKGLIELVEAFSKLKKEYHSVSLYLIGAKKDNAFY
FT                   HELIHRVKEAEINDVHILDAMQQKDVAVWMAAAEMFVLPSHLEGFGLVALEAMSCHTPV
FT                   VGSRVGGLAYLLGDGAGVLVEPGNPDSLFEGMKKLLDDAALRKQLVQKGEARAQENDQE
FT                   RIIDQILQLYDRV"
     MYPTETAKSF GIFVKNQVEA LRGRGLHVDV IAVTNPRTDK VNVLTKYILW LLRTLIHCVT        60
     KGRNYDVVHA HYVFPTGMLG LWYKKWWKAK LVVTAHGGDI DRMANKSGRI RQWTTTILRE       120
     ADHVIAVGHK LAEQIRNEFG VPEENVSVIN MGVNRRIFQP LDKEEARKRC GIGEHEIPIL       180
     FVGNIIRQKG LIELVEAFSK LKKEYHSVSL YLIGAKKDNA FYHELIHRVK EAEINDVHIL       240
     DAMQQKDVAV WMAAAEMFVL PSHLEGFGLV ALEAMSCHTP VVGSRVGGLA YLLGDGAGVL       300
     VEPGNPDSLF EGMKKLLDDA ALRKQLVQKG EARAQENDQE RIIDQILQLY DRV              353
//

If you have problems or comments...

PBIL Back to PBIL home page