(data stored in SCRATCH zone)

EMBL: CP002293.PE309

CP002293.PE309       Location/Qualifiers
FT   CDS             360253..361758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0320"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: drm:Dred_3098 integral membrane protein MviN;
FT                   TIGRFAM: integral membrane protein MviN; PFAM: virulence
FT                   factor MVIN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73165"
FT                   /db_xref="GOA:A0A0F6BIB4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB4"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADP73165.1"
FT                   /translation="MNRKRLFQIIGVVTVINILSRFFGFVREVMIGYHFGTSSLADSVV
FT                   LAYTIPNFLYLVLGGAVTTAYISIFSKMANDIEKQRFHNTVFTYMLIFLLLITAGLMVF
FT                   AKPIVAFFFSGLAGSQLLMTSQLFMITAPSALFLVFSMWFSGILNAQDQFYGAAVAALV
FT                   NNGMFVLLVVLLYPFCGIYAYGWGAVASAAVMLLILFVQLRKNNLHRFQFQLVTTEPEY
FT                   IARMLKIAVPVLFGGATLQLYIFIQRMFASQLEAGYVAALNYALKFVQLPQVILMTSVT
FT                   TVIYPMLAKKTAEKDYGGISSIFFRGLKSLFMIIVPVSVFVYFYAEEMVKLIFEYGSFT
FT                   AQSTKMTAMMLKIFIIGMFAQAANLFITRFFYAMEKSFVPVATGMISVFGVNILIIKLF
FT                   IGKYGADAVAWGTTVSAIVQFLMLAVASVVQLRLQPEKEAQWLRLILYALCATIAAAII
FT                   HKYIDFHHHIANIFIGGLTFVLVSLLLLKSFRLMSFQRLPMMK"
     MNRKRLFQII GVVTVINILS RFFGFVREVM IGYHFGTSSL ADSVVLAYTI PNFLYLVLGG        60
     AVTTAYISIF SKMANDIEKQ RFHNTVFTYM LIFLLLITAG LMVFAKPIVA FFFSGLAGSQ       120
     LLMTSQLFMI TAPSALFLVF SMWFSGILNA QDQFYGAAVA ALVNNGMFVL LVVLLYPFCG       180
     IYAYGWGAVA SAAVMLLILF VQLRKNNLHR FQFQLVTTEP EYIARMLKIA VPVLFGGATL       240
     QLYIFIQRMF ASQLEAGYVA ALNYALKFVQ LPQVILMTSV TTVIYPMLAK KTAEKDYGGI       300
     SSIFFRGLKS LFMIIVPVSV FVYFYAEEMV KLIFEYGSFT AQSTKMTAMM LKIFIIGMFA       360
     QAANLFITRF FYAMEKSFVP VATGMISVFG VNILIIKLFI GKYGADAVAW GTTVSAIVQF       420
     LMLAVASVVQ LRLQPEKEAQ WLRLILYALC ATIAAAIIHK YIDFHHHIAN IFIGGLTFVL       480
     VSLLLLKSFR LMSFQRLPMM K                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page