(data stored in ACNUC7421 zone)

EMBL: CP002293.PE31

CP002293.PE31        Location/Qualifiers
FT   CDS             43667..44545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0031"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: gwc:GWCH70_0031
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72887"
FT                   /db_xref="GOA:A0A0F6BHI6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI6"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADP72887.1"
FT                   /translation="MLWQQKSFEDNHKGTLYIVPTPIGNLEDMTFRAVRILQEVDMIAA
FT                   EDTRQTKKLLNHFQIRTPLISYHEHNKYTSGPQIVERLKAGESVALVSDAGMPGISDPG
FT                   HELVVSALEERCPVVPLPGANAALTALVASGLSTNHFYFFGFLERTKKEKKEQLESLKK
FT                   IRETMIFYEAPHRMQETLMMMHEVFGERRVVLCRELTKRFEEFIRGNLSEIVEWVSIHE
FT                   IRGEFCIVVEGAKETQEDEKTEAWWHSLTPVEHVEYYIREKNFTTKEAIKQTAKDRNMS
FT                   KREVYRQYHRQ"
     MLWQQKSFED NHKGTLYIVP TPIGNLEDMT FRAVRILQEV DMIAAEDTRQ TKKLLNHFQI        60
     RTPLISYHEH NKYTSGPQIV ERLKAGESVA LVSDAGMPGI SDPGHELVVS ALEERCPVVP       120
     LPGANAALTA LVASGLSTNH FYFFGFLERT KKEKKEQLES LKKIRETMIF YEAPHRMQET       180
     LMMMHEVFGE RRVVLCRELT KRFEEFIRGN LSEIVEWVSI HEIRGEFCIV VEGAKETQED       240
     EKTEAWWHSL TPVEHVEYYI REKNFTTKEA IKQTAKDRNM SKREVYRQYH RQ               292
//

If you have problems or comments...

PBIL Back to PBIL home page