(data stored in ACNUC7421 zone)

EMBL: CP002293.PE310

CP002293.PE310       Location/Qualifiers
FT   CDS             362067..363134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0321"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="PFAM: Glycosyl transferase, family 4, conserved
FT                   region; KEGG: gwc:GWCH70_3047 glycosyl transferase family
FT                   4"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73166"
FT                   /db_xref="GOA:A0A0F6BIB5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB5"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ADP73166.1"
FT                   /translation="MLYLWMTLLICFVCSVVLTPIVKKLAFAVGATDKPNYRKVHQKIM
FT                   PRLGGLAIYISFLIGYAILRPWNEDWMYILLGSLVIVVIGVLDDIYELPAKIKFFGQLI
FT                   AAFIVVVIGGLQVTFINLPFGGELHFGILSIPISIIWIVGITNAINLIDGLDGLAAGVS
FT                   AIALITISGMAIIMGDWFVSSVGIIMLGSTLGFLLYNFHPAKIFMGDTGALFLGYMISV
FT                   LALLGFKNVTFISFVIPVLILGVPISDTFFAIIRRIVKKQPLSAPDKSHLHHCLLRLGY
FT                   SHRQTVLIIYGMSALFGLIAIILSQAAVWVSMIILAVVLLALELVAEKIGLVDSNYRPI
FT                   LKIVRVIRYAGGKQN"
     MLYLWMTLLI CFVCSVVLTP IVKKLAFAVG ATDKPNYRKV HQKIMPRLGG LAIYISFLIG        60
     YAILRPWNED WMYILLGSLV IVVIGVLDDI YELPAKIKFF GQLIAAFIVV VIGGLQVTFI       120
     NLPFGGELHF GILSIPISII WIVGITNAIN LIDGLDGLAA GVSAIALITI SGMAIIMGDW       180
     FVSSVGIIML GSTLGFLLYN FHPAKIFMGD TGALFLGYMI SVLALLGFKN VTFISFVIPV       240
     LILGVPISDT FFAIIRRIVK KQPLSAPDKS HLHHCLLRLG YSHRQTVLII YGMSALFGLI       300
     AIILSQAAVW VSMIILAVVL LALELVAEKI GLVDSNYRPI LKIVRVIRYA GGKQN            355
//

If you have problems or comments...

PBIL Back to PBIL home page