(data stored in ACNUC7421 zone)

EMBL: CP002293.PE313

CP002293.PE313       Location/Qualifiers
FT   CDS             365106..366251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0324"
FT                   /product="DegS sensor signal transduction histidine kinase"
FT                   /note="KEGG: gwc:GWCH70_3044 sensor DegS domain protein;
FT                   PFAM: Sensor DegS domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; SMART: ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73169"
FT                   /db_xref="GOA:A0A0F6BIB8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008595"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016381"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB8"
FT                   /inference="protein motif:PFAM:PF05384"
FT                   /protein_id="ADP73169.1"
FT                   /translation="MSANKNLNVKELDKIVEKMIDTVQHSKDEIFRIGEQSRQEYEWMV
FT                   KELAEVKAAIHRTIEEADKLEVQTRRSRQRLSEVSRNFASHSENEIREAYEKAHELHME
FT                   LAMVREREKQLRLRRDELERRLIGLKETIERADHLVGQVTVVLNYLTSDFRQVGEFIEG
FT                   ARRKQEFGLKIIEAQEEERKRLSREIHDGPAQTLAHVIIRSDLMEKVLKDRGIEAAISE
FT                   IRDFKKMVRSALYEVRRIIYDLRPMALDDLGLVPTLRKYLQTVEDYSKGIDISFVHIGK
FT                   EMRLPPRLEVAVFRLVQEAVQNALKHAEATKIEVKTEMCSGQLLVMVKDDGKGFDTTMK
FT                   KENAFGLMGMKERVDLLEGTLTIRSKIGAGTTIFIRIPLNI"
     MSANKNLNVK ELDKIVEKMI DTVQHSKDEI FRIGEQSRQE YEWMVKELAE VKAAIHRTIE        60
     EADKLEVQTR RSRQRLSEVS RNFASHSENE IREAYEKAHE LHMELAMVRE REKQLRLRRD       120
     ELERRLIGLK ETIERADHLV GQVTVVLNYL TSDFRQVGEF IEGARRKQEF GLKIIEAQEE       180
     ERKRLSREIH DGPAQTLAHV IIRSDLMEKV LKDRGIEAAI SEIRDFKKMV RSALYEVRRI       240
     IYDLRPMALD DLGLVPTLRK YLQTVEDYSK GIDISFVHIG KEMRLPPRLE VAVFRLVQEA       300
     VQNALKHAEA TKIEVKTEMC SGQLLVMVKD DGKGFDTTMK KENAFGLMGM KERVDLLEGT       360
     LTIRSKIGAG TTIFIRIPLN I                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page