(data stored in SCRATCH zone)

EMBL: CP002293.PE314

CP002293.PE314       Location/Qualifiers
FT   CDS             366284..366964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0325"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: gwc:GWCH70_3043 two component transcriptional
FT                   regulator, LuxR family; PFAM: response regulator receiver;
FT                   regulatory protein LuxR; SMART: response regulator
FT                   receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73170"
FT                   /db_xref="GOA:A0A0F6BIB9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP73170.1"
FT                   /translation="MKTRIAIIDDHQLFREGMKRILEFEEEFEVVAEGADGSEALAIVE
FT                   QHRPDIVIMDINMPNTNGVEATRQLVEMYPDTKIVVLSIHDDENYVMRALQMGATGYLL
FT                   KDMDADTLIEAVKIVAEGGSYLHPKITHNLIREYRRLSAGKNEKEGEGKREARWPLHLL
FT                   TRRECEVLQLLADGKSNRGIGEALYISEKTVKNHVSNILQKLNVNDRTQAVIVAIKNGW
FT                   VEVR"
     MKTRIAIIDD HQLFREGMKR ILEFEEEFEV VAEGADGSEA LAIVEQHRPD IVIMDINMPN        60
     TNGVEATRQL VEMYPDTKIV VLSIHDDENY VMRALQMGAT GYLLKDMDAD TLIEAVKIVA       120
     EGGSYLHPKI THNLIREYRR LSAGKNEKEG EGKREARWPL HLLTRRECEV LQLLADGKSN       180
     RGIGEALYIS EKTVKNHVSN ILQKLNVNDR TQAVIVAIKN GWVEVR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page