(data stored in SCRATCH zone)

EMBL: CP002293.PE315

CP002293.PE315       Location/Qualifiers
FT   CDS             367066..367911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0326"
FT                   /product="degV family protein"
FT                   /note="KEGG: gwc:GWCH70_3042 DegV family protein; TIGRFAM:
FT                   degV family protein; PFAM: DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73171"
FT                   /db_xref="GOA:A0A0F6BIC0"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC0"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ADP73171.1"
FT                   /translation="MKTAIVTDSTAYIPKDVRDRLRIRMIPLSVAFGGETYREEVDISA
FT                   EQFFEKIKQHKELPTTSQPAVGEFVELFTSLREEGYDAVISIHLSSGISGTYQGALTAG
FT                   NMVDGLNVYAYDSEISCMAQGFYAIEAAKMALDGKTPEEIIARIDEMKKTLRAYFMVDD
FT                   LAHLQRGGRLTGAQAFIGGLLQIKPLLHFENKVIVPFEKIRTRKKAIKRIEELLAEDAA
FT                   KGVPLKAAIIHANRPDEAEQWKQQLSSLYPNVEFSISYFGPVIATHLGEGALGLTWYQP
FT                   "
     MKTAIVTDST AYIPKDVRDR LRIRMIPLSV AFGGETYREE VDISAEQFFE KIKQHKELPT        60
     TSQPAVGEFV ELFTSLREEG YDAVISIHLS SGISGTYQGA LTAGNMVDGL NVYAYDSEIS       120
     CMAQGFYAIE AAKMALDGKT PEEIIARIDE MKKTLRAYFM VDDLAHLQRG GRLTGAQAFI       180
     GGLLQIKPLL HFENKVIVPF EKIRTRKKAI KRIEELLAED AAKGVPLKAA IIHANRPDEA       240
     EQWKQQLSSL YPNVEFSISY FGPVIATHLG EGALGLTWYQ P                           281
//

If you have problems or comments...

PBIL Back to PBIL home page