(data stored in ACNUC7421 zone)

EMBL: CP002293.PE318

CP002293.PE318       Location/Qualifiers
FT   CDS             370443..372359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC3"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3039"
FT                   /protein_id="ADP73174.1"
FT                   /translation="MQVRNDFIMSEPAPFSLKEGETFFATVKEKLSNDEAIITVKGQDV
FT                   HVRFQGEIPKEDKVVVRIVGIKDHVLQVQAVPKAAETNGPAAGLFPAGELEKAEQILLA
FT                   QGIRLSKEEKAILRRFFEKAKGTLNEKLETVQALANKKLEVAESHLQAIHEALHGDSFG
FT                   ETLAQLADHLALLPSLRSSVENSLQALMGNGLQTSAEDNLQDWKENNHDFVSNGAKVFH
FT                   SPAETDLMEEQEIPQKNQSAETAESQQTESTYWNEEWMQAFPAPAKNIIVKTITEKLSQ
FT                   AALDFKKLQIEMNKKLENAAFLLDNGQTSARQQAKQLVEAVIRTLDRAILQGEFMLFTD
FT                   MKTEKQMLQASAKLAEAKQLLTEGKQSDALKAVKEVKHLLEGLRFQPADVKVKHFVSAH
FT                   PFSGEDPEAAPKQQLLPQLARILKFPLGEEVSARNTFEQFRQLGFHHEKDVFHALLSKQ
FT                   VAREPQNIKALLLKLSQGEFGVIAAQAEHAVANMTGQQLLSKFDAGNHMQTMFYQVPVL
FT                   LHDQMETVRIYLNARNDGGKLDWQNCSLYFLLDTEKYGKIGILLQALERDLTVTIKTDS
FT                   EKLTEALKALTETAKENLEEIGYNVKGITFAKLNHKYEEEKTAAETRKADERNSGKGYD
FT                   WKV"
     MQVRNDFIMS EPAPFSLKEG ETFFATVKEK LSNDEAIITV KGQDVHVRFQ GEIPKEDKVV        60
     VRIVGIKDHV LQVQAVPKAA ETNGPAAGLF PAGELEKAEQ ILLAQGIRLS KEEKAILRRF       120
     FEKAKGTLNE KLETVQALAN KKLEVAESHL QAIHEALHGD SFGETLAQLA DHLALLPSLR       180
     SSVENSLQAL MGNGLQTSAE DNLQDWKENN HDFVSNGAKV FHSPAETDLM EEQEIPQKNQ       240
     SAETAESQQT ESTYWNEEWM QAFPAPAKNI IVKTITEKLS QAALDFKKLQ IEMNKKLENA       300
     AFLLDNGQTS ARQQAKQLVE AVIRTLDRAI LQGEFMLFTD MKTEKQMLQA SAKLAEAKQL       360
     LTEGKQSDAL KAVKEVKHLL EGLRFQPADV KVKHFVSAHP FSGEDPEAAP KQQLLPQLAR       420
     ILKFPLGEEV SARNTFEQFR QLGFHHEKDV FHALLSKQVA REPQNIKALL LKLSQGEFGV       480
     IAAQAEHAVA NMTGQQLLSK FDAGNHMQTM FYQVPVLLHD QMETVRIYLN ARNDGGKLDW       540
     QNCSLYFLLD TEKYGKIGIL LQALERDLTV TIKTDSEKLT EALKALTETA KENLEEIGYN       600
     VKGITFAKLN HKYEEEKTAA ETRKADERNS GKGYDWKV                               638
//

If you have problems or comments...

PBIL Back to PBIL home page