(data stored in SCRATCH zone)

EMBL: CP002293.PE319

CP002293.PE319       Location/Qualifiers
FT   CDS             372356..372601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afl:Aflv_2591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73175"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC4"
FT                   /inference="similar to AA sequence:KEGG:Aflv_2591"
FT                   /protein_id="ADP73175.1"
FT                   /translation="MKNGYQHFSALASYQSGADQLTEPKIHTVNEIIKQAQQQRIPMQG
FT                   DSALVKHLVDPENRVPSQLYAVIGEILKLIKNIERQ"
     MKNGYQHFSA LASYQSGADQ LTEPKIHTVN EIIKQAQQQR IPMQGDSALV KHLVDPENRV        60
     PSQLYAVIGE ILKLIKNIER Q                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page